BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20094 (527 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29609| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_9316| Best HMM Match : SH2 (HMM E-Value=6.4) 38 0.004 SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) 38 0.007 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 38 0.007 SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) 37 0.009 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_25444| Best HMM Match : SH2 (HMM E-Value=6.4) 37 0.012 SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) 37 0.012 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 37 0.012 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 37 0.012 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 37 0.012 SB_16546| Best HMM Match : SH2 (HMM E-Value=6.4) 36 0.016 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 36 0.016 SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) 36 0.027 SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) 35 0.036 SB_47163| Best HMM Match : SH2 (HMM E-Value=6.4) 35 0.036 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.048 SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 33 0.11 SB_17007| Best HMM Match : VWA (HMM E-Value=4.6e-06) 33 0.11 SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 33 0.11 SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_43536| Best HMM Match : DUF1410 (HMM E-Value=3.5) 33 0.11 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.19 SB_53749| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.19 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.19 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 33 0.19 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 33 0.19 SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) 33 0.19 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 33 0.19 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 33 0.19 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 33 0.19 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.19 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 33 0.19 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) 33 0.19 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.19 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.19 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.19 SB_58751| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 32 0.25 SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6) 32 0.25 SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4) 32 0.25 SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6) 32 0.25 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6) 32 0.25 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.34 SB_54846| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_13983| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) 32 0.34 SB_44846| Best HMM Match : UME (HMM E-Value=2.6) 31 0.44 SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) 31 0.44 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_50765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_48773| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_11114| Best HMM Match : UPF0203 (HMM E-Value=9.6) 31 0.44 SB_35675| Best HMM Match : TB (HMM E-Value=8.4) 31 0.59 SB_10362| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.59 SB_28415| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 0.59 SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.59 SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.78 SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) 31 0.78 SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06) 31 0.78 SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_26710| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_12170| Best HMM Match : RVT_1 (HMM E-Value=0.58) 31 0.78 SB_10591| Best HMM Match : Spp-24 (HMM E-Value=6) 31 0.78 SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.78 SB_56412| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_44220| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_42325| Best HMM Match : RVT_1 (HMM E-Value=0.52) 31 0.78 SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.78 SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2) 31 0.78 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.78 SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) 31 0.78 SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) 31 0.78 SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.78 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_20661| Best HMM Match : DUF1274 (HMM E-Value=8.7) 31 0.78 SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) 31 0.78 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_10258| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) 31 0.78 SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.78 SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_2912| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) 30 1.0 SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) 30 1.0 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_29819| Best HMM Match : Ribosomal_L39 (HMM E-Value=4.1) 30 1.0 SB_15624| Best HMM Match : Phage_G (HMM E-Value=9.5) 30 1.0 SB_10529| Best HMM Match : zf-C2H2 (HMM E-Value=0.0034) 30 1.0 SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_11292| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58018| Best HMM Match : RVT_1 (HMM E-Value=1.1) 30 1.4 SB_48265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_9813| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) 29 1.8 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 29 1.8 SB_50918| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) 29 2.4 SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) 29 2.4 SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) 29 2.4 SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) 29 2.4 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 29 2.4 SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 3.1 SB_47925| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_42199| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_40223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_40188| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_35235| Best HMM Match : zf-CCCH (HMM E-Value=8) 29 3.1 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 29 3.1 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 29 3.1 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 3.1 SB_12067| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 3.1 SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) 29 3.1 SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 29 3.1 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 3.1 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 3.1 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 3.1 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 29 3.1 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) 29 3.1 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 3.1 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 3.1 SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_57495| Best HMM Match : G_glu_transpept (HMM E-Value=0) 28 4.1 SB_52531| Best HMM Match : RVT_1 (HMM E-Value=1e-08) 28 4.1 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 28 4.1 SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) 28 4.1 SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) 28 4.1 SB_4898| Best HMM Match : CaMBD (HMM E-Value=1.2) 28 4.1 SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 28 4.1 SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_50753| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) 28 4.1 SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_43443| Best HMM Match : Phage_fiber (HMM E-Value=3.8) 28 4.1 SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_36804| Best HMM Match : tRNA_int_endo (HMM E-Value=3.9) 28 4.1 SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) 28 4.1 SB_58492| Best HMM Match : DUF1196 (HMM E-Value=5) 28 5.5 SB_55051| Best HMM Match : RVT_1 (HMM E-Value=0.014) 28 5.5 SB_52360| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 28 5.5 SB_42604| Best HMM Match : DUF1196 (HMM E-Value=5) 28 5.5 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 28 5.5 SB_14424| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 28 5.5 SB_263| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 28 5.5 SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) 28 5.5 SB_54198| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_13145| Best HMM Match : Ribosomal_L30 (HMM E-Value=5.4) 28 5.5 SB_2372| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 28 5.5 SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) 27 7.2 SB_39596| Best HMM Match : TTL (HMM E-Value=0) 27 7.2 SB_33430| Best HMM Match : RVT_1 (HMM E-Value=1.3e-26) 27 7.2 SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_28387| Best HMM Match : RVT_1 (HMM E-Value=0.0013) 27 7.2 SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 27 7.2 SB_6920| Best HMM Match : RVT_1 (HMM E-Value=2.7e-06) 27 7.2 SB_5724| Best HMM Match : Vicilin_N (HMM E-Value=3) 27 7.2 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 27 7.2 SB_59432| Best HMM Match : MORN (HMM E-Value=9.3e-26) 27 7.2 SB_58995| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_47528| Best HMM Match : RVT_1 (HMM E-Value=9.9e-16) 27 7.2 SB_44566| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_43394| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_31165| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_16359| Best HMM Match : RVT_1 (HMM E-Value=0.00049) 27 7.2 SB_9990| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) 27 9.6 SB_53654| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_34436| Best HMM Match : SAM_1 (HMM E-Value=5.1) 27 9.6 SB_32921| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_29435| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_26855| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) 27 9.6 SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) 27 9.6 SB_47109| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_43054| Best HMM Match : SAM_1 (HMM E-Value=5.2) 27 9.6 SB_40130| Best HMM Match : SAM_1 (HMM E-Value=5.1) 27 9.6 SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 27 9.6 >SB_29609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 38.3 bits (85), Expect = 0.004 Identities = 21/61 (34%), Positives = 36/61 (59%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVH 446 KVK LG+ LD S+T+ H+K + ++ + LG L K+ +SL+ + Y + I+P+ Sbjct: 31 KVKLLGIRLDNSLTWDNHLKYIHNKNSKRLGLLKR---KKKFLSLKARTLFYHSLIQPIL 87 Query: 447 D 449 D Sbjct: 88 D 88 >SB_9316| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 169 Score = 38.3 bits (85), Expect = 0.004 Identities = 23/63 (36%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 KVK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 41 KVKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 95 Query: 441 VHD 449 + D Sbjct: 96 ILD 98 >SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 228 Score = 37.5 bits (83), Expect = 0.007 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 129 EVKLLGIRLDNSLTWNNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 183 Query: 441 VHD 449 + D Sbjct: 184 ILD 186 >SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 37.5 bits (83), Expect = 0.007 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 41 EVKLLGIRLDNSLTWNNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 95 Query: 441 VHD 449 + D Sbjct: 96 ILD 98 >SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) Length = 270 Score = 37.1 bits (82), Expect = 0.009 Identities = 21/61 (34%), Positives = 35/61 (57%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVH 446 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K L + Y + I+P+ Sbjct: 189 EVKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSARTLFYHSLIQPIL 243 Query: 447 D 449 D Sbjct: 244 D 244 >SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 36.7 bits (81), Expect = 0.012 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 173 EVKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 227 Query: 441 VHD 449 + D Sbjct: 228 ILD 230 >SB_25444| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 36.7 bits (81), Expect = 0.012 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 78 EVKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 132 Query: 441 VHD 449 + D Sbjct: 133 ILD 135 >SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 323 Score = 36.7 bits (81), Expect = 0.012 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 155 EVKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 209 Query: 441 VHD 449 + D Sbjct: 210 ILD 212 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 36.7 bits (81), Expect = 0.012 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 145 EVKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 199 Query: 441 VHD 449 + D Sbjct: 200 ILD 202 >SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 36.7 bits (81), Expect = 0.012 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 792 EVKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 846 Query: 441 VHD 449 + D Sbjct: 847 ILD 849 >SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) Length = 309 Score = 36.7 bits (81), Expect = 0.012 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 176 EVKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 230 Query: 441 VHD 449 + D Sbjct: 231 ILD 233 >SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 675 Score = 36.7 bits (81), Expect = 0.012 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 574 EVKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 628 Query: 441 VHD 449 + D Sbjct: 629 ILD 631 >SB_16546| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 124 Score = 36.3 bits (80), Expect = 0.016 Identities = 22/62 (35%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = +3 Query: 270 VKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRPV 443 VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P+ Sbjct: 42 VKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQPI 96 Query: 444 HD 449 D Sbjct: 97 LD 98 >SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) Length = 277 Score = 36.3 bits (80), Expect = 0.016 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y I+P Sbjct: 176 EVKLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHALIQP 230 Query: 441 VHD 449 + D Sbjct: 231 ILD 233 >SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 352 Score = 35.5 bits (78), Expect = 0.027 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +VK LG+ LD ++T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 263 EVKLLGIRLDNTLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 317 Query: 441 VHD 449 + D Sbjct: 318 ILD 320 >SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) Length = 816 Score = 35.1 bits (77), Expect = 0.036 Identities = 18/57 (31%), Positives = 34/57 (59%) Frame = +3 Query: 270 VKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 +K LGVTLD+S+T++ HI +V + + ++ + + + ++ V LYKT + P Sbjct: 675 LKILGVTLDSSLTYKEHITTVLKK---VYAKVAALRRIKRVVPIQTMVALYKTYVLP 728 >SB_47163| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 172 Score = 35.1 bits (77), Expect = 0.036 Identities = 21/63 (33%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK--MSLRNKVTLYKTCIRP 440 +V+ LG+ LD S+T+ H+K + ++ + LG L KR+K +SL+ + Y + I+P Sbjct: 41 EVQLLGIRLDNSLTWDNHLKYIHNKISKRLGLL-----KRTKKFLSLKARTLFYHSLIQP 95 Query: 441 VHD 449 + D Sbjct: 96 ILD 98 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 34.7 bits (76), Expect = 0.048 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMI-CKRSKMSLRNKVTLYKTCIRPV 443 + K LGVT+ +T+ HI + + I RLY + KR+ + ++ + Y TCIRPV Sbjct: 1177 QAKILGVTVSDDLTWNCHIAEILKK---INKRLYFLRQLKRANIKVKELLLFYLTCIRPV 1233 >SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 ++K LGVTLD + F HI + +A+ +G L + R+ + + K+ LYK+ I P Sbjct: 720 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVLVRL---RNLIPVDAKLQLYKSAILP 774 >SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 490 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 ++K LGVTLD + F HI + +A+ +G L + R+ + + K+ LYK+ I P Sbjct: 349 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVLVRL---RNLIPVDAKLQLYKSAILP 403 >SB_17007| Best HMM Match : VWA (HMM E-Value=4.6e-06) Length = 453 Score = 33.5 bits (73), Expect = 0.11 Identities = 28/93 (30%), Positives = 42/93 (45%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 280 DKSQFPYHLCGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 336 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G ++ P HT Sbjct: 337 CPAAVKEQAYKALVRP---LVEYGTKAWSP-HT 365 >SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 33.5 bits (73), Expect = 0.11 Identities = 28/93 (30%), Positives = 42/93 (45%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 102 DKSQFPYHLCGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 158 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 + K YK +RP L E G + P HT Sbjct: 159 CPVAVKEQAYKALVRP---LVEYGTEAWSP-HT 187 >SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 558 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 ++K LGVTLD + F HI + +A+ +G L + R+ + + K+ LYK+ I P Sbjct: 349 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVLVRL---RNLIPVDAKLQLYKSAILP 403 >SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 492 Score = 33.5 bits (73), Expect = 0.11 Identities = 17/57 (29%), Positives = 34/57 (59%) Frame = +3 Query: 270 VKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 +K LGVTLD+S+T++ HI +V + + ++ + + + ++ V LY+T + P Sbjct: 287 LKILGVTLDSSLTYKEHITTVLKK---VYAKVAALRRIKRLVPIQTMVALYRTYLLP 340 >SB_43536| Best HMM Match : DUF1410 (HMM E-Value=3.5) Length = 344 Score = 33.5 bits (73), Expect = 0.11 Identities = 21/58 (36%), Positives = 33/58 (56%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 ++K LGVTLD + F HI + +A+ +G L I R+ + + K+ LYK+ I P Sbjct: 160 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVL---IRLRNLIPVDAKLQLYKSAILP 214 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 32.7 bits (71), Expect = 0.19 Identities = 28/93 (30%), Positives = 41/93 (44%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 370 DKSQFPYHLCGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 426 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G + P HT Sbjct: 427 CPAAVKEQAYKALVRP---LVEYGTEAWSP-HT 455 >SB_53749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.7 bits (71), Expect = 0.19 Identities = 28/93 (30%), Positives = 41/93 (44%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 8 DKSQFPYHLYGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 64 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G + P HT Sbjct: 65 CPAAVKEQAYKALVRP---LVEYGTEAWSP-HT 93 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 32.7 bits (71), Expect = 0.19 Identities = 28/93 (30%), Positives = 41/93 (44%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 882 DKSQFPYHLYGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 938 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G + P HT Sbjct: 939 CPAAVKEQAYKALVRP---LVEYGTEAWSP-HT 967 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 866 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCPQRVKVTAYTAIVR 920 Query: 438 PV 443 P+ Sbjct: 921 PM 922 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 172 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCPQRVKVTAYTAIVR 226 Query: 438 PV 443 P+ Sbjct: 227 PM 228 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 158 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCHQRVKVTAYTAIVR 212 Query: 438 PV 443 P+ Sbjct: 213 PM 214 >SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) Length = 843 Score = 32.7 bits (71), Expect = 0.19 Identities = 28/93 (30%), Positives = 41/93 (44%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 609 DKSQFPYHLCGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 665 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G + P HT Sbjct: 666 CPAAVKEQAYKALVRP---LVEYGTEAWSP-HT 694 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 404 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCPQRVKVTAYTAIVR 458 Query: 438 PV 443 P+ Sbjct: 459 PM 460 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 690 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCPQRVKVTAYTAIVR 744 Query: 438 PV 443 P+ Sbjct: 745 PM 746 >SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) Length = 823 Score = 32.7 bits (71), Expect = 0.19 Identities = 28/93 (30%), Positives = 41/93 (44%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 362 DKSQFPYHLCGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 418 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G + P HT Sbjct: 419 CPAAVKEQAYKALVRP---LVEYGTEAWSP-HT 447 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 378 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCPQRVKVTAYTAIVR 432 Query: 438 PV 443 P+ Sbjct: 433 PM 434 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 75 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCPQRVKVTAYTAIVR 129 Query: 438 PV 443 P+ Sbjct: 130 PM 131 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 621 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCPQRVKVTAYTAIVR 675 Query: 438 PV 443 P+ Sbjct: 676 PM 677 >SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 32.7 bits (71), Expect = 0.19 Identities = 28/93 (30%), Positives = 41/93 (44%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 188 DKSQFPYHLCGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 244 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G + P HT Sbjct: 245 CPAAVKEQAYKALVRP---LVEYGTEAWSP-HT 273 >SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 32.7 bits (71), Expect = 0.19 Identities = 28/93 (30%), Positives = 41/93 (44%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 102 DKSQFPYHLCGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 158 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G + P HT Sbjct: 159 CPAAVKEQAYKALVRP---LVEYGTEAWSP-HT 187 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 580 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCPQRVKVTAYTAIVR 634 Query: 438 PV 443 P+ Sbjct: 635 PM 636 >SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) Length = 304 Score = 32.7 bits (71), Expect = 0.19 Identities = 28/93 (30%), Positives = 41/93 (44%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 83 DKSQFPYHLCGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 139 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G + P HT Sbjct: 140 CPAAVKEQAYKALVRP---LVEYGTEAWSP-HT 168 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 463 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCPQRVKVTAYTAIVR 517 Query: 438 PV 443 P+ Sbjct: 518 PM 519 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 32.7 bits (71), Expect = 0.19 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + YLGV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 396 QSITYLGVILNDDLKWSKHVKSTSGKASKVMGMM-----KRNFWNCPQRVKVTAYTAIVR 450 Query: 438 PV 443 P+ Sbjct: 451 PM 452 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 32.7 bits (71), Expect = 0.19 Identities = 28/93 (30%), Positives = 41/93 (44%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 814 DKSQFPYHLCGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SS 870 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G + P HT Sbjct: 871 CPAAVKEQAYKALVRP---LVEYGTEAWSP-HT 899 >SB_58751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 32.3 bits (70), Expect = 0.25 Identities = 28/93 (30%), Positives = 41/93 (44%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSK 392 ++S P + TT KYLGV + S+ + H + V+ +A +LG L + S Sbjct: 87 DKSQFPYHLCGTTLEGVSVQKYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SP 143 Query: 393 MSLRNKVTLYKTCIRPVHDLRECGVRSRGPAHT 491 K YK +RP L E G + P HT Sbjct: 144 CPAAVKEQAYKALVRP---LVEYGTEAWSP-HT 172 >SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) Length = 434 Score = 32.3 bits (70), Expect = 0.25 Identities = 19/60 (31%), Positives = 30/60 (50%) Frame = +3 Query: 261 ARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 A +K LGVT+D+ + F HI A +G L + R+ + K+ LYK+ + P Sbjct: 303 ADSLKLLGVTIDSQLNFSEHISIACKNAGRRIGVLMRL---RNLIPTNAKLVLYKSAVLP 359 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 224 TELSMYADDHQIYHCGRDPGVVTAKLSAS 252 >SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S+ + GRL + +++ K+ +Y C+ P+ Sbjct: 80 KYLGSILSSDCSMRAELTSLIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 136 >SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4) Length = 288 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S+ + GRL + +++ K+ +Y C+ P+ Sbjct: 80 KYLGSILSSDCSMRAELTSLIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 136 >SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S+ + GRL + +++ K+ +Y C+ P+ Sbjct: 80 KYLGSILSSDCSMRAELTSLIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 136 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 32.3 bits (70), Expect = 0.25 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 K LGVT+ ++ ++ HI +A L ++ KR+++ + + + Y TC+RP+ Sbjct: 594 KILGVTISNNLQWKSHINYAIKKANKCSHFL--VLLKRARVPVSDIIGFYNTCVRPI 648 >SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 32.3 bits (70), Expect = 0.25 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S+ + GRL + +++ K+ +Y C+ P+ Sbjct: 80 KYLGSILSSDCSMRAELTSLIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 136 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 31.9 bits (69), Expect = 0.34 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS--KMSLRNKVTLYKTCIR 437 + + Y+GV L+ + + H+KS +A+ ++G + KR+ R KVT Y +R Sbjct: 588 QSITYIGVILNDDLKWSKHVKSTSGKASKVMGMI-----KRNFWNCPQRVKVTAYTAIVR 642 Query: 438 PV 443 P+ Sbjct: 643 PM 644 >SB_54846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.9 bits (69), Expect = 0.34 Identities = 16/57 (28%), Positives = 33/57 (57%) Frame = +3 Query: 270 VKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 VKYLGV +D ++TF+ HI+ + + + +G + + R + + + +Y++ I P Sbjct: 93 VKYLGVLIDKNLTFKYHIEHITTKISRTVGLIAKL---RHFVPTKTLLHIYQSLILP 146 >SB_13983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 31.9 bits (69), Expect = 0.34 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 264 RKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++VKYLGVT+ + + H+ V RA ILG L Sbjct: 131 KEVKYLGVTITHNFRWHKHVADVTKRANKILGLL 164 >SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) Length = 323 Score = 31.9 bits (69), Expect = 0.34 Identities = 16/57 (28%), Positives = 33/57 (57%) Frame = +3 Query: 270 VKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 VKYLGV +D ++TF+ HI+ + + + +G + + R + + + +Y++ I P Sbjct: 257 VKYLGVLIDKNLTFKYHIEHITTKISRTVGLIAKL---RHFVPTKTLLHIYQSLILP 310 >SB_44846| Best HMM Match : UME (HMM E-Value=2.6) Length = 133 Score = 31.5 bits (68), Expect = 0.44 Identities = 18/59 (30%), Positives = 33/59 (55%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 ++KYLGV + +S+ + + V+ +A +LG L + S S+R K Y + +RP+ Sbjct: 36 RLKYLGVYITSSLRWDMQAEEVKKKANRVLGVLQRNL---SSCSVRIKERAYTSLVRPI 91 >SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) Length = 1130 Score = 31.5 bits (68), Expect = 0.44 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMIC-KRSKMSLRNKVTLYKTCIRPV 443 K L VT+ S+ + HI ++ + RLY ++ KR+ + + + + Y TC+RP+ Sbjct: 245 KILSVTISNSLQWNSHINDTIEK---VNKRLYFLVLLKRTIVPVSDIIGFYDTCVRPI 299 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 31.5 bits (68), Expect = 0.44 Identities = 22/72 (30%), Positives = 36/72 (50%) Frame = +3 Query: 246 TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYK 425 T P A+ V LGVT+ +++ PHI+ + +A +LG L +C + + LY Sbjct: 577 TLDPLAQ-VTDLGVTITKDLSWGPHIEPMCAKANRVLG-LLKRVCS-DILDPTTRQLLYC 633 Query: 426 TCIRPVHDLREC 461 T +RP + C Sbjct: 634 TLVRPSLEYASC 645 >SB_50765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYK 425 K YLG TL ++ + + + + GRLY + R ++ R K+ +Y+ Sbjct: 164 KFNYLGSTLSRNVVIDDEVNARLAKGSAAFGRLYKNVWNRRGITTRTKIKVYR 216 >SB_48773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 31.5 bits (68), Expect = 0.44 Identities = 18/59 (30%), Positives = 33/59 (55%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 ++KYLGV + +S+ + + V+ +A +LG L + S S+R K Y + +RP+ Sbjct: 36 RLKYLGVYITSSLRWDMQAEEVKKKANRVLGVLQRNL---SSCSVRIKERAYTSLVRPI 91 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 31.5 bits (68), Expect = 0.44 Identities = 22/72 (30%), Positives = 36/72 (50%) Frame = +3 Query: 246 TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYK 425 T P A+ V LGVT+ +++ PHI+ + +A +LG L +C + + LY Sbjct: 80 TLDPLAQ-VTDLGVTITKDLSWGPHIEPMCAKANRVLG-LLKRVCS-DILDPTTRQLLYC 136 Query: 426 TCIRPVHDLREC 461 T +RP + C Sbjct: 137 TLVRPSLEYASC 148 >SB_11114| Best HMM Match : UPF0203 (HMM E-Value=9.6) Length = 197 Score = 31.5 bits (68), Expect = 0.44 Identities = 24/73 (32%), Positives = 34/73 (46%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVHDL 452 KYLGV + S+ + H + V+ +A +LG L + S K YK +RP L Sbjct: 54 KYLGVHISTSLNWSKHTEEVKKKANAVLGILQRNL---SSCPAAVKEQAYKALVRP---L 107 Query: 453 RECGVRSRGPAHT 491 E G + P HT Sbjct: 108 VEYGTEAWSP-HT 119 >SB_35675| Best HMM Match : TB (HMM E-Value=8.4) Length = 251 Score = 31.1 bits (67), Expect = 0.59 Identities = 20/55 (36%), Positives = 29/55 (52%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 +LGV LD +T PHI +V + + +G +Y K SL +TLY + I P Sbjct: 66 FLGVVLDEHLTRIPHISNVTRKVSKAVGIMYKASFCLPKRSL---MTLYYSLIFP 117 >SB_10362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 31.1 bits (67), Expect = 0.59 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + RA+ GRL + KR + K+ +Y+ + P Sbjct: 111 KFTYLGSTLSRNVVLDDEVTNRLARASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 168 >SB_28415| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 356 Score = 31.1 bits (67), Expect = 0.59 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + RA+ GRL + KR + K+ +Y+ + P Sbjct: 111 KFTYLGSTLSRNVVLDDEVTNRLARASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 168 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 31.1 bits (67), Expect = 0.59 Identities = 19/65 (29%), Positives = 33/65 (50%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVH 446 +V LGVT+ +++ PHI+ + +A +LG L +C + + LY T +RP Sbjct: 86 QVTVLGVTITNDLSWGPHIEPMCAKANRVLG-LVKRVCS-DILDPTTRQLLYCTLVRPHL 143 Query: 447 DLREC 461 + C Sbjct: 144 EYASC 148 >SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 80 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 136 >SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 559 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 416 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 472 >SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) Length = 1074 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 860 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 916 >SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06) Length = 744 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 530 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 586 >SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 387 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 173 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 229 >SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 221 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 277 >SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 700 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 756 >SB_26710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 30.7 bits (66), Expect = 0.78 Identities = 15/57 (26%), Positives = 33/57 (57%) Frame = +3 Query: 270 VKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 +K LGVT+D+S++++ HI + + + ++ + + + ++ V LYKT + P Sbjct: 131 LKILGVTMDSSLSYKRHISTALKK---VYAKVAALRRIKRLVPIQTMVALYKTYVVP 184 >SB_12170| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 294 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 190 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 246 >SB_10591| Best HMM Match : Spp-24 (HMM E-Value=6) Length = 225 Score = 30.7 bits (66), Expect = 0.78 Identities = 18/59 (30%), Positives = 31/59 (52%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVHD 449 KYLGV + +S+ + K V+ + +LG L + S S+R K Y + +RP+ + Sbjct: 84 KYLGVYITSSLCWGMQAKEVKKKGNRVLGVLQRNL---SSCSVRIKEQAYMSLVRPIFE 139 >SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 202 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 35 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 91 >SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 591 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 339 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 395 >SB_56412| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 35 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 91 >SB_44220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 221 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 277 >SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 35 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 91 >SB_42325| Best HMM Match : RVT_1 (HMM E-Value=0.52) Length = 333 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 190 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 246 >SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 675 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 464 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 520 >SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2) Length = 294 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 80 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 136 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 30.7 bits (66), Expect = 0.78 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YLGV +++ + PH + D+A +LG L + S++ K Y T +RP+ Sbjct: 316 YLGVRCSSNLRWGPHASKISDKANKVLGLLRRTLKPCSQLV---KERAYFTLVRPI 368 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 11 THLALFADDTTVYYSSRN 64 +HL LFADDT VY + R+ Sbjct: 238 SHLRLFADDTVVYRNIRS 255 >SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 35 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 91 >SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 30.7 bits (66), Expect = 0.78 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YLGV +++ + PH + D+A +LG L + S++ K Y T +RP+ Sbjct: 204 YLGVRCSSNLRWGPHASKISDKANKVLGLLRRTLKPCSQLV---KERAYFTLVRPI 256 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 11 THLALFADDTTVYYSSRN 64 +HL LFADDT VY + R+ Sbjct: 126 SHLRLFADDTVVYRNIRS 143 >SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 359 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 190 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 246 >SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) Length = 210 Score = 30.7 bits (66), Expect = 0.78 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YLGV +++ + PH + D+A +LG L + S++ K Y T +RP+ Sbjct: 6 YLGVRCSSNLRWGPHASKISDKANKVLGLLRRTLKPCSQLV---KERAYFTLVRPI 58 >SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 636 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 425 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 481 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 30.7 bits (66), Expect = 0.78 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YLGV +++ + PH + D+A +LG L + S++ K Y T +RP+ Sbjct: 160 YLGVRCSSNLRWGPHASKISDKANKVLGLLRRTLKPCSQLV---KERAYFTLVRPI 212 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 11 THLALFADDTTVYYSSRN 64 +HL LFADDT VY + R+ Sbjct: 82 SHLRLFADDTVVYRNIRS 99 >SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 226 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 12 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 68 >SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 35 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 91 >SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 35 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 91 >SB_20661| Best HMM Match : DUF1274 (HMM E-Value=8.7) Length = 208 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 145 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 201 >SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) Length = 435 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 221 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 277 >SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 30.7 bits (66), Expect = 0.78 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YLGV +++ + PH + D+A +LG L + S++ K Y T +RP+ Sbjct: 111 YLGVRCSSNLRWGPHASKISDKANKVLGLLRRTLKPCSQLV---KERAYFTLVRPI 163 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 11 THLALFADDTTVYYSSRN 64 +HL LFADDT VY + R+ Sbjct: 33 SHLRLFADDTVVYRNIRS 50 >SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 35 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 91 >SB_10258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 30.7 bits (66), Expect = 0.78 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YLGV +++ + PH + D+A +LG L + S++ K Y T +RP+ Sbjct: 80 YLGVRCSSNLRWGPHASKISDKANKVLGLLRRTLKPCSQLV---KERAYFTLVRPI 132 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 11 THLALFADDTTVYYSSRN 64 +HL LFADDT VY + R+ Sbjct: 2 SHLRLFADDTVVYRNIRS 19 >SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) Length = 404 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 190 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 246 >SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 80 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 136 >SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 30.7 bits (66), Expect = 0.78 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YLGV +++ + PH + D+A +LG L + S++ K Y T +RP+ Sbjct: 350 YLGVRCSSNLRWGPHASKISDKANKVLGLLRRTLKPCSQLV---KERAYFTLVRPI 402 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 11 THLALFADDTTVYYSSRN 64 +HL LFADDT VY + R+ Sbjct: 272 SHLRLFADDTVVYRNIRS 289 >SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 235 Score = 30.7 bits (66), Expect = 0.78 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 67 KYLGSILSSDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 123 >SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 30.3 bits (65), Expect = 1.0 Identities = 19/65 (29%), Positives = 33/65 (50%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVH 446 +V LGVT+ +++ PHI+ + +A +LG L +C + + LY T +RP Sbjct: 38 QVTDLGVTITNDLSWGPHIEPMCAKANRVLG-LVKRVCS-DILDPTTRQLLYCTLVRPHL 95 Query: 447 DLREC 461 + C Sbjct: 96 EYASC 100 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMI-CKRSKMSLRNKVTLYKTCIRP 440 + K LGVT + + + H+ V + + RLY + KR+ + + + Y TCIRP Sbjct: 633 QAKILGVTFSSDLKWNAHVDEVIKK---VNKRLYFLRQLKRAHVKPKELILFYLTCIRP 688 >SB_2912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLGV + +S+ + + V+ +A +LG L + S S+R K Y + +RP+ Sbjct: 26 KYLGVYITSSLRWDMQAEEVKKKANRVLGVLQRNL---SSCSVRIKERAYMSLVRPI 79 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 30.3 bits (65), Expect = 1.0 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 261 ARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRS 389 A +K LGVT+D+ + F HI A +GR + KRS Sbjct: 966 ADSLKLLGVTIDSQLNFSEHISIACKNAGRRIGRWSLFVKKRS 1008 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 887 TELSMYADDHQIYHCGRDPGVVTAKLSAS 915 >SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) Length = 1354 Score = 30.3 bits (65), Expect = 1.0 Identities = 19/65 (29%), Positives = 33/65 (50%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVH 446 +V LGVT+ +++ PHI+ + +A +LG L +C + + LY T +RP Sbjct: 831 QVTDLGVTITNDLSWGPHIEPMCAKANRVLG-LVKRVCS-DILDPTTRQLLYCTLVRPHL 888 Query: 447 DLREC 461 + C Sbjct: 889 EYASC 893 >SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) Length = 838 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLGV + +S+ + + V+ +A +LG L + S S+R K Y + +RP+ Sbjct: 406 KYLGVYITSSLRWDMQAEEVKKKANRVLGVLQRNL---SSCSVRIKERAYTSLVRPI 459 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 30.3 bits (65), Expect = 1.0 Identities = 19/65 (29%), Positives = 33/65 (50%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVH 446 +V LGVT+ +++ PHI+ + +A +LG L +C + + LY T +RP Sbjct: 1724 QVTDLGVTITNDLSWGPHIEPMCAKANRVLG-LVKRVCS-DILDPTTRQLLYCTLVRPHL 1781 Query: 447 DLREC 461 + C Sbjct: 1782 EYASC 1786 >SB_29819| Best HMM Match : Ribosomal_L39 (HMM E-Value=4.1) Length = 300 Score = 30.3 bits (65), Expect = 1.0 Identities = 19/65 (29%), Positives = 34/65 (52%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVH 446 +V LGVT+ +++ PHI+ + +A +LG L +C + ++ LY T +RP Sbjct: 214 QVTDLGVTITNDLSWGPHIEPMCAKANRVLG-LAKRVCS-DILDPTSRQLLYCTLVRPHL 271 Query: 447 DLREC 461 + C Sbjct: 272 EYASC 276 >SB_15624| Best HMM Match : Phage_G (HMM E-Value=9.5) Length = 288 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/57 (31%), Positives = 31/57 (54%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLGV + +S+ + + V+ +A +LG L + S S+R K Y + +RP+ Sbjct: 97 KYLGVYITSSLRWDMQAEEVKKKANRVLGVLQRNL---SSCSVRIKERAYTSLVRPI 150 >SB_10529| Best HMM Match : zf-C2H2 (HMM E-Value=0.0034) Length = 272 Score = 30.3 bits (65), Expect = 1.0 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + RA+ GRL + KR + K+ +Y+ + P Sbjct: 27 KFIYLGSTLSRNVVLDDEVTNRLARASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 84 >SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 30.3 bits (65), Expect = 1.0 Identities = 19/65 (29%), Positives = 33/65 (50%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVH 446 +V LGVT+ +++ PHI+ + +A +LG L +C + + LY T +RP Sbjct: 507 QVTDLGVTITNDLSWGPHIEPMCAKANRVLG-LVKRVCS-DILDPTTRQLLYCTLVRPHL 564 Query: 447 DLREC 461 + C Sbjct: 565 EYASC 569 >SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 29.9 bits (64), Expect = 1.4 Identities = 19/65 (29%), Positives = 33/65 (50%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVH 446 +V LGVT+ +++ PHI+ + +A +LG L +C + + LY T +RP Sbjct: 91 QVTDLGVTITNDLSWGPHIEPMCAKANRVLG-LVKRVCS-DILDPTTRQLLYCTFVRPHL 148 Query: 447 DLREC 461 + C Sbjct: 149 EYASC 153 >SB_11292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1529 Score = 29.9 bits (64), Expect = 1.4 Identities = 19/78 (24%), Positives = 36/78 (46%) Frame = +3 Query: 255 PWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 P K LGVT+ + H+ +A L + ++ KR+++ + + + Y + I Sbjct: 632 PVVTNAKILGVTITEDLKCNAHVSECIKKANKRL--CFIVMLKRAQLPIMDIIAFYLSTI 689 Query: 435 RPVHDLRECGVRSRGPAH 488 RPV + G + PA+ Sbjct: 690 RPVLEYCAPGFHNALPAY 707 >SB_58018| Best HMM Match : RVT_1 (HMM E-Value=1.1) Length = 386 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/63 (26%), Positives = 30/63 (47%) Frame = +3 Query: 255 PWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 P K LGVT+ + H+ +A L + ++ KR+++ + N + Y + I Sbjct: 204 PVVTNAKILGVTITEDFKWNAHVSECIKKANKRL--CFIVMLKRAQLPVMNIIAFYLSTI 261 Query: 435 RPV 443 RPV Sbjct: 262 RPV 264 >SB_48265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 29.9 bits (64), Expect = 1.4 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLGV + +S+ + V+ +A +LG L + S S+R K Y + +RP+ Sbjct: 82 KYLGVYITSSLRWDMQADEVKKKANRVLGVLQRYL---SSCSVRIKERAYTSLVRPI 135 >SB_9813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 29.9 bits (64), Expect = 1.4 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +3 Query: 213 EESHTPDYSL*TTHPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++S P + TT KYLGV + S+ + H + V+ +A +LG L Sbjct: 99 DKSQFPYHLCGTTLEGVNVQKYLGVHISTSLNWSKHTEEVKKKANAVLGIL 149 >SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 404 Score = 29.5 bits (63), Expect = 1.8 Identities = 14/57 (24%), Positives = 25/57 (43%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 KYLG L + R + S + GRL + +++ K+ +Y C+ P+ Sbjct: 190 KYLGSILSNDCSMRAELTSRIQAVSCAYGRLRKRVFDSRDLTVPTKIAVYNQCLMPL 246 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 55 YLGSTTSANGCLDVELGKRIGKAVTTMSKLSSRVWENKKLTISTKITVYRACI 107 >SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) Length = 773 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMI-CKRSKMSLRNKVTLYKTCIRP 440 + K LGVT + + + H+ V + + RLY + KR+ + + + Y TCIRP Sbjct: 640 QAKILGVTFTSDLKWNVHVDEVIKK---VNKRLYFLRQLKRAHVKPKELILFYLTCIRP 695 >SB_50918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 29.1 bits (62), Expect = 2.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 258 WARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLY 368 + ++KYLGVT+ + + H+ +A ILG L+ Sbjct: 742 FVEEIKYLGVTITRDLRWNRHVAETVSKANKILGLLW 778 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +2 Query: 176 GEAPHGFPPGLGGGISHPRLLSLDNPSLGQEG-QVPGR-YPG 295 G PHG PPG G +H + ++ P G G + GR +PG Sbjct: 288 GMPPHGMPPGFGPDQAHMQFEAMGFPGRGGGGMRGRGRGFPG 329 >SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) Length = 283 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPM-ICKRSKMSLRNKVTLYKTCIRPV 443 K+LGV + +++ H++ V +A RLY + + K++ +S+ + T+Y IR V Sbjct: 155 KFLGVFISHDLSWNNHVEHVLSKAN---KRLYALRLLKKAGLSVHDLCTIYCALIRSV 209 >SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) Length = 499 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPM-ICKRSKMSLRNKVTLYKTCIRPV 443 K+LGV + +++ H++ V +A RLY + + K++ +S+ + T+Y IR V Sbjct: 375 KFLGVFISHDLSWNNHVEHVLSKAN---KRLYALRLLKKAGLSVHDLCTIYCALIRSV 429 >SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012) Length = 558 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 279 LGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 LGVT+D + F HI + RA+ G L + R+ + K+ L+K+ + P Sbjct: 216 LGVTIDDQINFSTHINEICKRASQRAGVLMRL---RNLIPTNAKLQLFKSAVLP 266 >SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) Length = 284 Score = 29.1 bits (62), Expect = 2.4 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPM-ICKRSKMSLRNKVTLYKTCIRPV 443 K+LGV + +++ H++ V +A RLY + + K++ +S+ + T+Y IR V Sbjct: 117 KFLGVFISHDLSWNNHVEHVLSKAN---KRLYALRLLKKAGLSVHDLCTIYCALIRSV 171 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YLGV +++ + PH + ++A +LG L + S++ K Y T +RP+ Sbjct: 366 YLGVRCSSNLRWGPHASKISEKANKVLGLLRRTLKPCSQLV---KERAYFTLVRPI 418 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 11 THLALFADDTTVYYSSRN 64 +HL LFADDT VY + R+ Sbjct: 288 SHLRLFADDTVVYRNIRS 305 >SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 370 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 139 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 191 >SB_47925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YL TL S+ + +A+ GRL + R +S++ K+ +YK + P+ Sbjct: 52 YLCSTLSRSVCIDAEVDGRIAKASTAFGRLRKKVWGRRGLSMKTKLKVYKAIVLPL 107 >SB_42199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YL TL S+ + +A+ GRL + R +S++ K+ +YK + P+ Sbjct: 52 YLCSTLSRSVCIDAEVDGRIAKASTAFGRLRKKVWGRRGLSMKTKLKVYKAIVLPL 107 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 525 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 577 >SB_40223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 YLG T+ T I + +A+ LG+L + + + L K+ +Y + P Sbjct: 334 YLGSTISNDNTLYKEIAARIQKASHALGKLLTKVLQHQDIRLSTKLKVYNAIVLP 388 >SB_40188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +3 Query: 249 THPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPM-ICKRSKMSLRNKVTLYK 425 TH K LGV + + +++ H+ V +A RLY + + K+S + +++ + +Y Sbjct: 58 THMRVESYKILGVHISSDLSWNKHVDYVVKKAN---KRLYALRLLKKSGVPVQDLIAIYC 114 Query: 426 TCIRPV 443 IR V Sbjct: 115 VLIRSV 120 >SB_35235| Best HMM Match : zf-CCCH (HMM E-Value=8) Length = 119 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 149 RKVLRCYFRGEAPHGFPP-GLGGGISHPRLLSLDNPSLGQEG 271 ++ + C F G +P G PP G+ G SH ++ PS GQ G Sbjct: 31 KRDVNCPFHGASPRGMPPSGILGLPSHHGMI----PSYGQHG 68 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 279 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 331 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 487 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 539 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 56 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 108 >SB_12067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 YLGV + +S+ + + V+ +A +LG L + R S+R K Y + +RP+ Sbjct: 85 YLGVYITSSLRWDMQAEEVKKKANRVLGVLQRNLSSR---SVRIKERAYMSLVRPI 137 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 159 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 211 >SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 56 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 108 >SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 173 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 56 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 108 >SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 56 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 108 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 276 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 328 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 56 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 108 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 569 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 621 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 108 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 160 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 56 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 108 >SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 322 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 205 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 257 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 91 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 143 >SB_26245| Best HMM Match : Homeobox (HMM E-Value=1.7e-32) Length = 1168 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +2 Query: 173 RGEAPHGFPPGLGGGISHPRLLSLDNPSLGQEGQVPGRYPG 295 RG AP+ P G G G S P +SL + + GQ P PG Sbjct: 491 RGNAPNMSPVGTGSG-SLPPHMSLPSYAAVLHGQAPQSMPG 530 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 165 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 217 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 108 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 160 >SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 56 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 108 >SB_57495| Best HMM Match : G_glu_transpept (HMM E-Value=0) Length = 761 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 258 WARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 + ++KYLGVT+ + + H+ +A ILG L Sbjct: 548 FVEEIKYLGVTITRDLRWNRHVAETVSKANKILGLL 583 >SB_52531| Best HMM Match : RVT_1 (HMM E-Value=1e-08) Length = 309 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 YLG T+ T I + +A+ LG+L + + + L K+ +Y + P Sbjct: 242 YLGSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRLSTKLKVYNAIVLP 296 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ C+ Sbjct: 447 YLGSTTSANGCLDVELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACV 499 >SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) Length = 270 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 258 WARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 + ++KYLGVT+ + + H+ +A ILG L Sbjct: 191 FVEEIKYLGVTITRDLRWNRHVAETVSKANKILGLL 226 >SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) Length = 231 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 258 WARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 + ++KYLGVT+ + + H+ +A ILG L Sbjct: 34 FVEEIKYLGVTITRDLRWNRHVAETVSKANKILGLL 69 >SB_4898| Best HMM Match : CaMBD (HMM E-Value=1.2) Length = 259 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 YLG T+ T I + +A+ LG+L + + + L K+ +Y + P Sbjct: 107 YLGSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIHLSTKLKVYNAVVLP 161 >SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085) Length = 576 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL I KR + K+ +Y+ + P Sbjct: 342 KFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNIWKRRGIRTDTKIKVYRAVVLP 399 >SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1395 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 887 KFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIKTDTKIKVYRAVVLP 944 >SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 686 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 YLG T+ T I + +A+ LG+L + + + L K+ +Y + P Sbjct: 391 YLGSTISNDNTLDKEIAARIQKASHALGKLCTKVLQHQDIRLSTKLKVYNAIVLP 445 >SB_50753| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) Length = 401 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 YLG T+ T I + +A+ LG+L + + + L K+ +Y + P Sbjct: 162 YLGSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRLSTKLKVYNAIVLP 216 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 YLG T+ T I + +A+ LG+L + + + L K+ +Y + P Sbjct: 3156 YLGSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRLSTKLKVYNAIVLP 3210 >SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 258 WARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 + ++KYLGVT+ + + H+ +A ILG L Sbjct: 34 FVEEIKYLGVTITRDLRWNRHVAETVSKANKILGLL 69 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCI 434 YLG T A+ + +A + +L + + K+++ K+T+Y+ CI Sbjct: 2367 YLGSTTSANGCLDIELGKRIGKAVTTMTKLSSRVWENKKLTISTKITVYRACI 2419 >SB_43443| Best HMM Match : Phage_fiber (HMM E-Value=3.8) Length = 266 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 YLG T+ T I + +A+ LG+L + + + L K+ +Y + P Sbjct: 165 YLGSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRLSTKLKVYNAIVLP 219 >SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K GVT+D + F HI + RA+ G L + R+ + K+ L+K+ + P Sbjct: 353 KVSGVTIDYQLNFSTHINEICKRASQRAGVLMRL---RNLIPTNAKLQLFKSTVLP 405 >SB_36804| Best HMM Match : tRNA_int_endo (HMM E-Value=3.9) Length = 229 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 YLG T+ T I + +A+ LG+L + + + L K+ +Y + P Sbjct: 79 YLGSTISNDNTLDKEIAARIQKASHALGKLCTKVLQHQDIRLSTKLKVYNAIVLP 133 >SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 YLG T+ T I + +A+ LG+L + + + L K+ +Y + P Sbjct: 558 YLGSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRLSTKLKVYNAIVLP 612 >SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) Length = 1195 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +3 Query: 276 YLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 YLG T+ T I + +A+ LG+L + + + L K+ +Y + P Sbjct: 926 YLGSTISNDNTLDKEIAARIQKASHALGKLRTKVLQHQDIRLSTKLKVYNAIVLP 980 >SB_58492| Best HMM Match : DUF1196 (HMM E-Value=5) Length = 283 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 110 KFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 167 >SB_55051| Best HMM Match : RVT_1 (HMM E-Value=0.014) Length = 372 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 210 KFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 267 >SB_52360| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 455 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 210 KFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 267 >SB_42604| Best HMM Match : DUF1196 (HMM E-Value=5) Length = 294 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 111 KFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 168 >SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) Length = 858 Score = 27.9 bits (59), Expect = 5.5 Identities = 18/65 (27%), Positives = 32/65 (49%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVH 446 +V L VT+ +++ PHI+ + +A +LG L +C + + LY T +RP Sbjct: 680 QVTDLDVTITKDLSWGPHIEPMCAKANRVLG-LVKRVCS-DILDPTTRQLLYCTLVRPHL 737 Query: 447 DLREC 461 + C Sbjct: 738 EYASC 742 >SB_14424| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 272 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 27 KFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 84 >SB_263| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 272 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 27 KFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 84 >SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) Length = 1092 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 847 KFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 904 >SB_54198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 27.9 bits (59), Expect = 5.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 258 WARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 + ++KYLGVT+ + + H+ +A ILG L Sbjct: 229 FVEEIKYLGVTITRDVRWNRHVAETVSKANKILGLL 264 >SB_13145| Best HMM Match : Ribosomal_L30 (HMM E-Value=5.4) Length = 199 Score = 27.9 bits (59), Expect = 5.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 258 WARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 + ++KYLGVT+ + + H+ +A ILG L Sbjct: 25 FVEEIKYLGVTITRDVRWNRHVAETVSKANKILGLL 60 >SB_2372| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 414 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 169 KFTYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 226 >SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) Length = 792 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 273 KYLGVTLDASMTFRPHI 323 K LG+TLD MTF HI Sbjct: 751 KLLGITLDGQMTFEVHI 767 >SB_39596| Best HMM Match : TTL (HMM E-Value=0) Length = 808 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 96 TELSMYADDHQIYHCGRDPGVVTAKLSAS 124 >SB_33430| Best HMM Match : RVT_1 (HMM E-Value=1.3e-26) Length = 288 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 177 TELSMYADDHQIYHCGRDPGVVTAKLSAS 205 >SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2271 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 2159 TELSMYADDHQIYHCGRDPGVVTAKLSAS 2187 >SB_28387| Best HMM Match : RVT_1 (HMM E-Value=0.0013) Length = 220 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 177 TELSMYADDHQIYHCGRDPGVVTAKLSAS 205 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 194 FPPGLGGGISHPRLLSLDNPSLGQEGQVPG 283 F G GG + +P+L+S D + EG +PG Sbjct: 987 FAMGGGGWLDYPQLISADLRKMTVEGLLPG 1016 >SB_6920| Best HMM Match : RVT_1 (HMM E-Value=2.7e-06) Length = 250 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 139 TELSMYADDHQIYHCGRDPGVVTAKLSAS 167 >SB_5724| Best HMM Match : Vicilin_N (HMM E-Value=3) Length = 861 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -3 Query: 399 GTFYSAYRSWGRVYRE*TRHGHGLILYAGGMSSMH 295 G F Y + R Y TRH GLI Y GG +S + Sbjct: 417 GGFTRHYGGFTRHYGGFTRHYGGLISYNGGFTSYY 451 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 495 TELSMYADDHQIYHCGRDPGVVTAKLSAS 523 >SB_59432| Best HMM Match : MORN (HMM E-Value=9.3e-26) Length = 1362 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -3 Query: 360 YRE*TRHGHGLILYAGGMSS 301 +R+ TRHGHG++ Y G MSS Sbjct: 1213 WRDNTRHGHGVMSY-GAMSS 1231 >SB_58995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 5 TELSMYADDHQIYHCGRDPGVVTAKLSAS 33 >SB_47528| Best HMM Match : RVT_1 (HMM E-Value=9.9e-16) Length = 228 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 177 TELSMYADDHQIYHCGRDPGVVTAKLSAS 205 >SB_44566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 351 ILGRLYPMICKRSKMSLRNKVTLYKTCIRPVHD 449 ++G + P +CK S +N L K CIRP + Sbjct: 192 VMGLVDPRMCKVSSKWSQNIRVLIKDCIRPAEE 224 >SB_43394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 42 TELSMYADDHQIYHCGRDPGVVTAKLSAS 70 >SB_31165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 39 TELSMYADDHQIYHCGRDPGVVTAKLSAS 67 >SB_16359| Best HMM Match : RVT_1 (HMM E-Value=0.00049) Length = 220 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 177 TELSMYADDHQIYHCGRDPGVVTAKLSAS 205 >SB_9990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +2 Query: 11 THLALFADDTTVYYSSRNKSLIAKKLQSA 97 T L+++ADD +Y+ R+ ++ KL ++ Sbjct: 177 TELSMYADDHQIYHCGRDPGVVTAKLSAS 205 >SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) Length = 575 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++K LGVTLD + F HI + +A+ +G L Sbjct: 543 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVL 575 >SB_53654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++K LGVTLD + F HI + +A+ +G L Sbjct: 149 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVL 181 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 11 THLALFADDTTVYYSSRN 64 +HL LFADDT VY + R+ Sbjct: 555 SHLRLFADDTVVYRNIRS 572 >SB_34436| Best HMM Match : SAM_1 (HMM E-Value=5.1) Length = 119 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++K LGVTLD + F HI + +A+ +G L Sbjct: 87 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVL 119 >SB_32921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++K LGVTLD + F HI + +A+ +G L Sbjct: 87 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVL 119 >SB_29435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 11 THLALFADDTTVYYSSRN 64 +HL LFADDT VY + R+ Sbjct: 33 SHLRLFADDTVVYRNIRS 50 >SB_26855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++K LGVTLD + F HI + +A+ +G L Sbjct: 240 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVL 272 >SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) Length = 326 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++K LGVTLD + F HI + +A+ +G L Sbjct: 294 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVL 326 >SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) Length = 775 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++K LGVTLD + F HI + +A+ +G L Sbjct: 738 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVL 770 >SB_47109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 27 KFIYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 84 >SB_43054| Best HMM Match : SAM_1 (HMM E-Value=5.2) Length = 119 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++K LGVTLD + F HI + +A+ +G L Sbjct: 87 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVL 119 >SB_40130| Best HMM Match : SAM_1 (HMM E-Value=5.1) Length = 181 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRL 365 ++K LGVTLD + F HI + +A+ +G L Sbjct: 149 EMKLLGVTLDDKLNFSLHISEICKKASQKVGVL 181 >SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 1443 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +3 Query: 267 KVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRP 440 K YLG TL ++ + + A+ GRL + KR + K+ +Y+ + P Sbjct: 1198 KFIYLGSTLSRNVVLDDEVTNRLAIASAAFGRLRKNVWKRRGIRTDTKIKVYRAVVLP 1255 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,523,965 Number of Sequences: 59808 Number of extensions: 366561 Number of successful extensions: 1463 Number of sequences better than 10.0: 215 Number of HSP's better than 10.0 without gapping: 1317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1461 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1197191618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -