BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20094 (527 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF036692-9|AAB88330.1| 389|Caenorhabditis elegans Hypothetical ... 29 2.7 Z68104-8|CAA92117.1| 1077|Caenorhabditis elegans Hypothetical pr... 27 8.3 Z66563-4|CAA91470.1| 1077|Caenorhabditis elegans Hypothetical pr... 27 8.3 AF435953-1|AAL30829.1| 1077|Caenorhabditis elegans eIF2 alpha ki... 27 8.3 AF193341-1|AAF61201.1| 1077|Caenorhabditis elegans eukaryotic tr... 27 8.3 >AF036692-9|AAB88330.1| 389|Caenorhabditis elegans Hypothetical protein C44B12.7 protein. Length = 389 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +3 Query: 279 LGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPV 443 LG+ D+ +TF+PHIK + + L R ++ + L+KT I P+ Sbjct: 198 LGILTDSKLTFKPHIKKI---VSLALLRCKQLLKSFKSLCPEFYCNLFKTYILPL 249 >Z68104-8|CAA92117.1| 1077|Caenorhabditis elegans Hypothetical protein F46C3.1 protein. Length = 1077 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 456 ECGVRSRGPAHT*TPSNPTI 515 EC + S GP T TP NP I Sbjct: 165 ECSMESCGPGDTETPKNPII 184 >Z66563-4|CAA91470.1| 1077|Caenorhabditis elegans Hypothetical protein F46C3.1 protein. Length = 1077 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 456 ECGVRSRGPAHT*TPSNPTI 515 EC + S GP T TP NP I Sbjct: 165 ECSMESCGPGDTETPKNPII 184 >AF435953-1|AAL30829.1| 1077|Caenorhabditis elegans eIF2 alpha kinase protein. Length = 1077 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 456 ECGVRSRGPAHT*TPSNPTI 515 EC + S GP T TP NP I Sbjct: 165 ECSMESCGPGDTETPKNPII 184 >AF193341-1|AAF61201.1| 1077|Caenorhabditis elegans eukaryotic translation initiationfactor 2 alpha kinase PEK protein. Length = 1077 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 456 ECGVRSRGPAHT*TPSNPTI 515 EC + S GP T TP NP I Sbjct: 165 ECSMESCGPGDTETPKNPII 184 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,491,072 Number of Sequences: 27780 Number of extensions: 259251 Number of successful extensions: 616 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1038911524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -