BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20092 (738 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 26 0.37 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 23 3.4 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 7.9 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 25.8 bits (54), Expect = 0.37 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 437 WKLGPRGEPEPTSTCRSARTR 375 WK P+G P P+ST S T+ Sbjct: 67 WKKSPQGAPSPSSTPSSLPTQ 87 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +1 Query: 439 CAEGWQVGPGSVHWQRARWQDPRLLGLGRV 528 C E ++GP VH ++ + G G+V Sbjct: 296 CQEAERLGPAGVHLRKKNIHSCHIPGCGKV 325 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 22.6 bits (46), Expect = 3.4 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +1 Query: 484 RARWQDPRLLGLGRVGREVATRMYAFGMNIIGFDPFVSADQCAQFH 621 R W DPRL R G E + F NI D F ++ + FH Sbjct: 93 RQFWTDPRLAYGKRPGVETLSVGSEFIKNIWVPDTFFVNEKQSYFH 138 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 425 PRGEPEPTSTCRSARTRSA 369 P EP+PT T S T+++ Sbjct: 397 PTPEPQPTQTTESEPTQAS 415 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,891 Number of Sequences: 336 Number of extensions: 3176 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -