BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20091 (714 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 1.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 1.9 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 3.3 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 22 5.7 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 7.5 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +1 Query: 208 CWAFGAVEAMTDRVCTILTELNIFIFLPRICLVAALFVDWDAAE 339 C+ G V + + C+I L + + + I A+ FV W E Sbjct: 195 CFVPGVVAMFSRKPCSINENLKMGLDIASITAQASSFVVWPLVE 238 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +1 Query: 208 CWAFGAVEAMTDRVCTILTELNIFIFLPRICLVAALFVDWDAAE 339 C+ G V + + C+I L + + + I A+ FV W E Sbjct: 195 CFVPGVVAMFSRKPCSINENLKMGLDIASITAQASSFVVWPLVE 238 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -3 Query: 595 VVFVSGHSIYMFSVLFVLFVINVVSRFAF 509 +VFV + IY+F+V ++ + ++ S F Sbjct: 143 LVFVFCYFIYLFTVYYIYYSVHEASIINF 171 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 465 CCRVRDVHTEGSRKV 421 C + D H EG RKV Sbjct: 70 CAKCNDKHKEGIRKV 84 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 7.5 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +3 Query: 474 CSGDTKTPKCTKN 512 C+GD + P C +N Sbjct: 553 CNGDNRPPDCGQN 565 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,867 Number of Sequences: 336 Number of extensions: 4381 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -