BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20091 (714 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 5.0 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 6.6 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 6.6 AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family p... 21 8.8 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.2 bits (45), Expect = 5.0 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -1 Query: 672 LLYDSKSEYTVKAPSTGPFLNNSARMWSSSPDTV-YTCFPYCLSCL*LT 529 +L +S+ + P GP ARM + + D V FP+ + L +T Sbjct: 371 MLLSGRSQKSTTGPPPGPTPAQKARMRALNIDRVSRVFFPFLFAVLNVT 419 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 400 TIPVKVADLTRSLRVNITYP 459 T+P++ DLT+S +ITYP Sbjct: 95 TLPIE--DLTKSDNEDITYP 112 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 400 TIPVKVADLTRSLRVNITYP 459 T+P++ DLT+S +ITYP Sbjct: 133 TLPIE--DLTKSDNEDITYP 150 >AF134820-1|AAD40235.1| 166|Apis mellifera putative Ets-family protein protein. Length = 166 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 588 KTTSAPNCSRMVRSKVLSQYIQIC 659 + TS PN SR+ +S++ Q C Sbjct: 93 RITSVPNTSRLDKSEISLATKQAC 116 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,200 Number of Sequences: 438 Number of extensions: 4801 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -