BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20088X (386 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56628| Best HMM Match : Actin (HMM E-Value=0) 118 1e-27 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 3e-26 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 112 8e-26 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 111 2e-25 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 111 2e-25 SB_56| Best HMM Match : Actin (HMM E-Value=0) 109 6e-25 SB_54| Best HMM Match : Actin (HMM E-Value=0) 59 1e-09 SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) 54 3e-08 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 51 4e-07 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6) 41 3e-04 SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_18097| Best HMM Match : NadA (HMM E-Value=2.2) 31 0.25 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_21074| Best HMM Match : NadA (HMM E-Value=2) 31 0.33 SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) 31 0.33 SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 31 0.33 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 31 0.43 SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17) 30 0.76 SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) 30 0.76 SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.0 SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8) 29 1.0 SB_56842| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) 29 1.8 SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 29 1.8 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) 29 1.8 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 29 1.8 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 29 1.8 SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 29 1.8 SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 28 3.1 SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 28 3.1 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 28 3.1 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 28 3.1 SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 28 3.1 SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) 28 3.1 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 28 3.1 SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.0 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 27 4.0 SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.0 SB_46582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.0 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 27 4.0 SB_10020| Best HMM Match : Extensin_2 (HMM E-Value=0.88) 27 4.0 SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) 27 5.3 SB_25562| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 27 7.1 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 27 7.1 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 27 7.1 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_59800| Best HMM Match : SPRY (HMM E-Value=7.8e-05) 26 9.3 SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_34833| Best HMM Match : E6 (HMM E-Value=7.2) 26 9.3 SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.3 SB_9298| Best HMM Match : rve (HMM E-Value=4.8e-35) 26 9.3 SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24) 26 9.3 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 26 9.3 SB_15747| Best HMM Match : Ribosomal_L17 (HMM E-Value=2.5) 26 9.3 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 118 bits (285), Expect = 1e-27 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = +3 Query: 87 MCDEDVAAVVVDNGSGMCKAGFAGDVAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHR 266 MCD+DVAA+VVDNGSGMCKAGFAGD APRAVFPSIVGRPRHQGVMVGMGQKDSYVG + Sbjct: 1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60 Query: 267 AK 272 +K Sbjct: 61 SK 62 Score = 100 bits (240), Expect = 4e-22 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 385 +EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE Sbjct: 57 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 100 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 114 bits (274), Expect = 3e-26 Identities = 51/62 (82%), Positives = 57/62 (91%) Frame = +3 Query: 87 MCDEDVAAVVVDNGSGMCKAGFAGDVAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHR 266 M D+D+AA+V+DNGSGMCKAGFAGD APRAVFPSIVGRPRHQGVMVGMGQKDSYVG + Sbjct: 1 MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60 Query: 267 AK 272 +K Sbjct: 61 SK 62 Score = 100 bits (240), Expect = 4e-22 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 385 +EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE Sbjct: 57 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 100 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 112 bits (270), Expect = 8e-26 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = +3 Query: 93 DEDVAAVVVDNGSGMCKAGFAGDVAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHRAK 272 D+DVAA+V+DNGSGMCKAGFAGD APRAVFPSIVGRPRHQGVMVGMGQKDSYVG ++K Sbjct: 2 DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61 Score = 70.1 bits (164), Expect = 6e-13 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF 358 +EAQSKRGILTLKYPIEHGIVTNWDDMEKI TF Sbjct: 56 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIMFETF 90 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 111 bits (267), Expect = 2e-25 Identities = 51/62 (82%), Positives = 57/62 (91%) Frame = +3 Query: 87 MCDEDVAAVVVDNGSGMCKAGFAGDVAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHR 266 M D+++AA+VVDNGSGMCKAGFAGD APRAVFPSIVGRPRHQGVMVGMGQKDSYVG + Sbjct: 1 MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60 Query: 267 AK 272 +K Sbjct: 61 SK 62 Score = 100 bits (240), Expect = 4e-22 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 385 +EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE Sbjct: 57 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 100 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 111 bits (267), Expect = 2e-25 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = +3 Query: 93 DEDVAAVVVDNGSGMCKAGFAGDVAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHRAK 272 ++DVAA+VVDNGSGMCKAGFAGD APRAVFPSIVGRPRHQGVMVGMGQKDSYVG ++K Sbjct: 2 EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61 Score = 100 bits (240), Expect = 4e-22 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 385 +EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE Sbjct: 56 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 99 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 109 bits (263), Expect = 6e-25 Identities = 50/60 (83%), Positives = 56/60 (93%) Frame = +3 Query: 93 DEDVAAVVVDNGSGMCKAGFAGDVAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHRAK 272 +++VAA+VVDNGSGMCKAGFAGD APRAVFPSIVGRPRHQGVMVGMGQKDSYVG ++K Sbjct: 2 EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61 Score = 100 bits (240), Expect = 4e-22 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 385 +EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE Sbjct: 56 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 99 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 59.3 bits (137), Expect = 1e-09 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 111 VVVDNGSGMCKAGFAGDVAPRAVFPSIVGRPRHQ 212 VV+DNGSG CKAG + D +PR VFP+IVGRPRH+ Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130 >SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) Length = 1392 Score = 54.4 bits (125), Expect = 3e-08 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +3 Query: 111 VVVDNGSGMCKAGFAGDVAPRAVFPSIVGRPRHQ 212 +V+D GS M K GFAGD AP+ VFP IVGRPRHQ Sbjct: 1359 LVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 50.8 bits (116), Expect = 4e-07 Identities = 21/49 (42%), Positives = 32/49 (65%) Frame = +3 Query: 81 FKMCDEDVAAVVVDNGSGMCKAGFAGDVAPRAVFPSIVGRPRHQGVMVG 227 FK+ A+V+DNG G+ K GFAGD PR + P++VG P+ +++G Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIG 741 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 48.8 bits (111), Expect = 2e-06 Identities = 20/50 (40%), Positives = 32/50 (64%) Frame = +2 Query: 209 SGRDGRYGTEGLLCRNEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF 358 S + G + L+ +EA R +L + YP+++GIV NWDDM+ +W +TF Sbjct: 44 SQKVGDIEVKDLMVGDEASQLRYMLEVNYPMDNGIVRNWDDMKHVWDYTF 93 Score = 43.2 bits (97), Expect = 8e-05 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +3 Query: 105 AAVVVDNGSGMCKAGFAGDVAPRAVFPSIVGRP 203 + +V DNG+G K G+AG P +FPS+VGRP Sbjct: 7 SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRP 39 >SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6) Length = 372 Score = 41.1 bits (92), Expect = 3e-04 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 385 +EA K T K+PI H IV +WD ME+ W + LR PE Sbjct: 288 DEAIDKPSYAT-KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPE 330 >SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -1 Query: 209 MAGPSHDRGEHGARSNISCETGLAHTGAIV 120 MA + D GE+G+ S +S ETGLAHTGAI+ Sbjct: 1 MARSADDGGENGSGSIVSGETGLAHTGAII 30 >SB_18097| Best HMM Match : NadA (HMM E-Value=2.2) Length = 272 Score = 31.5 bits (68), Expect = 0.25 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLAHT 132 V+LSH + H M D +HG RS SCET L T Sbjct: 224 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVPT 259 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 31.1 bits (67), Expect = 0.33 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLAHT 132 V+LSH + H M D +HG RS SCET L T Sbjct: 419 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 454 >SB_21074| Best HMM Match : NadA (HMM E-Value=2) Length = 358 Score = 31.1 bits (67), Expect = 0.33 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLAHT 132 V+LSH + H M D +HG RS SCET L T Sbjct: 282 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 317 >SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) Length = 339 Score = 31.1 bits (67), Expect = 0.33 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLAHT 132 V+LSH + H M D +HG RS SCET L T Sbjct: 260 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 295 >SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 31.1 bits (67), Expect = 0.33 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLAHT 132 V+LSH + H M D +HG RS SCET L T Sbjct: 102 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 31.1 bits (67), Expect = 0.33 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLAHT 132 V+LSH + H M D +HG RS SCET L T Sbjct: 102 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137 >SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 31.1 bits (67), Expect = 0.33 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLAHT 132 V+LSH + H M D +HG RS SCET L T Sbjct: 136 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 171 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 30.7 bits (66), Expect = 0.43 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLAHT 132 ++LSH + H M D +HG RS SCET L T Sbjct: 184 IVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 219 >SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17) Length = 635 Score = 29.9 bits (64), Expect = 0.76 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +2 Query: 179 VPLDRGKAPPSGRDGRYGTEGLLCRNEAQSKRGILTLKYPIEHGIVTNW--DDMEKIWHH 352 V L + +GR+ G+ +CR +A ++TL + I G+ + D EK+W+H Sbjct: 441 VTLSQNVVSVTGREESGGSGTQVCRKKAP----LITLSHVIRMGLALSLVSDVKEKVWYH 496 Query: 353 TFYN 364 T N Sbjct: 497 TCPN 500 >SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) Length = 580 Score = 29.9 bits (64), Expect = 0.76 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 296 PIEHGIVTNWDDMEKIWHHTFYNE 367 P + G + NWD ++IW +TF E Sbjct: 292 PFQKGFLVNWDVEKQIWDYTFGKE 315 >SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.5 bits (63), Expect = 1.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 184 GNTARGATSPAKPALHIPEP 125 GNT R PAKPAL++P P Sbjct: 80 GNTNRRTRIPAKPALNLPSP 99 >SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8) Length = 170 Score = 29.5 bits (63), Expect = 1.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 184 GNTARGATSPAKPALHIPEP 125 GNT R PAKPAL++P P Sbjct: 80 GNTNRRTRIPAKPALNLPSP 99 >SB_56842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 318 VTIPCSMGYLRVRIPLLLCASFLHKSPSVP 229 V PC M LRVR+ C S LH + P Sbjct: 60 VACPCCMSLLRVRVVCPCCMSVLHVRVACP 89 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -3 Query: 336 SMSSQLVTIPCSMGYLRVRIPLLLCASFLHKSPSVP 229 S+ V PC M L VR+ C S LH + P Sbjct: 2 SLLRDRVVCPCCMSVLCVRVACPCCVSVLHVRVACP 37 >SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) Length = 419 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLA---HTGAIVYYHRGNI 99 ++LSH + H L A +HG R +SCET L H A H G + Sbjct: 253 IVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLTFHDWATTLNHHGQV 302 >SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLA---HTGAIVYYHRGNI 99 ++LSH + H L A +HG R +SCET L H A H G + Sbjct: 114 IVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLTFHDWATTLNHHGQV 163 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLA---HTGAIVYYHRGNI 99 ++LSH + H L A +HG R +SCET L H A H G + Sbjct: 1652 IVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLTFHDWATTLNHHGQV 1701 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLA---HTGAIVYYHRGNI 99 ++LSH + H L A +HG R +SCET L H A H G + Sbjct: 680 IVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLTFHDWATTLNHHGQV 729 >SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) Length = 329 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLA---HTGAIVYYHRGNI 99 ++LSH + H L A +HG R +SCET L H A H G + Sbjct: 235 IVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLTFHDWATTLNHHGQV 284 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLA---HTGAIVYYHRGNI 99 ++LSH + H L A +HG R +SCET L H A H G + Sbjct: 1090 IVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLTFHDWATTLNHHGQV 1139 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLA---HTGAIVYYHRGNI 99 ++LSH + H L A +HG R +SCET L H A H G + Sbjct: 33 IVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLTFHDWATTLNHHGQV 82 >SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 28.7 bits (61), Expect = 1.8 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGLA---HTGAIVYYHRGNI 99 ++LSH + H L A +HG R +SCET L H A H G + Sbjct: 114 IVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLTFHDWATTLNHHGQV 163 >SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 28.3 bits (60), Expect = 2.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 184 GNTARGATSPAKPALHIPEP 125 GNT R PAKP+L++P P Sbjct: 540 GNTNRRTRIPAKPSLNLPSP 559 >SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) Length = 291 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL---AHTGAIVYYHRGNIFVAHLE 81 V+LSH + H L A +HG R+ SCET L H A + G + V L+ Sbjct: 4 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHGQVDVLLLD 59 >SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9) Length = 209 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL---AHTGAIVYYHRGNIFVAHLE 81 V+LSH + H L A +HG R+ SCET L H A + G + V L+ Sbjct: 104 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHGQVDVLLLD 159 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL---AHTGAIVYYHRGNIFVAHLE 81 V+LSH + H L A +HG R+ SCET L H A + G + V L+ Sbjct: 104 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHGQVDVLLLD 159 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL---AHTGAIVYYHRGNIFVAHLE 81 V+LSH + H L A +HG R+ SCET L H A + G + V L+ Sbjct: 474 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHGQVDVLLLD 529 >SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) Length = 221 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL---AHTGAIVYYHRGNIFVAHLE 81 V+LSH + H L A +HG R+ SCET L H A + G + V L+ Sbjct: 137 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHGQVDVLLLD 192 >SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) Length = 224 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL---AHTGAIVYYHRGNIFVAHLE 81 V+LSH + H L A +HG R+ SCET L H A + G + V L+ Sbjct: 54 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHGQVDVLLLD 109 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL---AHTGAIVYYHRGNIFVAHLE 81 V+LSH + H L A +HG R+ SCET L H A + G + V L+ Sbjct: 726 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHGQVDVLLLD 781 >SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 27.9 bits (59), Expect = 3.1 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 84 KMCDEDVAAVVVDNG-SGMCKAGFAGD 161 ++CD+D + +N MCKAG+ GD Sbjct: 487 RLCDKDAVCRLENNAIKCMCKAGYTGD 513 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL---AHTGAIVYYHRGNIFVAHLE 81 V+LSH + H L A +HG R+ SCET L H A + G + V L+ Sbjct: 810 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHGQVDVLLLD 865 >SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 27.5 bits (58), Expect = 4.0 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 212 GRDGRYGTEGLLCRNEAQSKRGIL-TLKYPIEHGIVTNWDDMEKIWHHTF 358 GR G + GL N+ S I L+ P + +VT+++ E++ H F Sbjct: 105 GRKGEPDSGGLAVGNDIGSVEMIRWALRTPFDRDVVTHYECQEQVLDHAF 154 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 27.5 bits (58), Expect = 4.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 255 FLHKSPSVPYRPSRPDGGAFPRSRGTRREEQ 163 ++++ PS RP P+G P G REE+ Sbjct: 234 YMNRGPSFANRPPGPEGYRRPSHEGASREER 264 >SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 635 Score = 27.5 bits (58), Expect = 4.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 184 GNTARGATSPAKPALHIPEP 125 GNT R PAKP L IP P Sbjct: 68 GNTNRRTRIPAKPTLTIPSP 87 >SB_46582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 4.0 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 4/29 (13%) Frame = -3 Query: 159 LLRNRPCTYRSHCLLPPRQ----HLRRTS 85 +LRNRP T+R LP Q HLR+T+ Sbjct: 58 ILRNRPITFRLQVCLPSLQTAFNHLRKTT 86 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 27.5 bits (58), Expect = 4.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H L A +HG RS SCET L Sbjct: 4 IVLSHLNKH-LSAFNILSEMQHGFRSGFSCETQL 36 >SB_10020| Best HMM Match : Extensin_2 (HMM E-Value=0.88) Length = 379 Score = 27.5 bits (58), Expect = 4.0 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 330 SSQLVTI--PCSMGYLRV-RIPLLLCASFLHKSPSVPYRP 220 S LV++ P S Y + RIP LC L PS PY+P Sbjct: 260 SPSLVSLQAPLSYSYKPLPRIPSSLCLLSLQAPPSYPYKP 299 >SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) Length = 428 Score = 27.1 bits (57), Expect = 5.3 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 192 RSRGTRREEQHLLRNRPCTYRSHCLLPPRQHLRRTS 85 RSR + R + R+ YRS P R+H R TS Sbjct: 324 RSRSSERRRRSRSRSTEHRYRSRSRSPRRKHRRSTS 359 >SB_25562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 27.1 bits (57), Expect = 5.3 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +2 Query: 182 PLDRGKAPPSGRDGRYGTEGLLCRNEAQSKRGILTL 289 PL R A GRDG + + RNEA+ KR I L Sbjct: 523 PLGRVTAVCEGRDGYVRSVTVKTRNEAELKRPIAKL 558 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 27.1 bits (57), Expect = 5.3 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = -1 Query: 275 LFCSVPHSYIRVLLSHTDHHALMAGPSHDRGEHGARSNISCETGLAHT 132 L C + ++LSH + H L +HG R +SCET L T Sbjct: 854 LTCLCCKTMEHIVLSHLNKH-LSRFNILSNAQHGFRQGLSCETQLVLT 900 >SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H D +HG RS SCET L Sbjct: 140 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 172 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H D +HG RS SCET L Sbjct: 4 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 36 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H D +HG RS SCET L Sbjct: 481 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 513 >SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 411 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H D +HG RS SCET L Sbjct: 89 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 121 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H D +HG RS SCET L Sbjct: 1207 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 1239 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H D +HG RS SCET L Sbjct: 1871 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 1903 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H D +HG RS SCET L Sbjct: 191 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 223 >SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H D +HG RS SCET L Sbjct: 81 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 113 >SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H D +HG RS SCET L Sbjct: 159 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 191 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSNISCETGL 141 ++LSH + H D +HG RS SCET L Sbjct: 220 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 252 >SB_59800| Best HMM Match : SPRY (HMM E-Value=7.8e-05) Length = 1444 Score = 26.2 bits (55), Expect = 9.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 249 HKSPSVPYRPSRPDGGAFPRSRGTRREEQHLLR 151 H S Y+ PD A+ R + T+R Q LLR Sbjct: 25 HYSVKTGYKRITPDKAAYTRIKPTKRVTQALLR 57 >SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1705 Score = 26.2 bits (55), Expect = 9.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 179 VPLDRGKAPPSGRDGRYGTEGLLCRNEAQSKRG 277 +P G+A P G G G G++ N A K+G Sbjct: 93 LPGPLGEAGPPGSQGSPGAPGIIGMNGAMGKKG 125 >SB_34833| Best HMM Match : E6 (HMM E-Value=7.2) Length = 135 Score = 26.2 bits (55), Expect = 9.3 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 159 LLRNRPCTYRSHCLLP 112 L R R C YRSH LLP Sbjct: 52 LFRGRYCQYRSHNLLP 67 >SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.2 bits (55), Expect = 9.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 184 GNTARGATSPAKPALHIPEP 125 GNT R AKPAL++P P Sbjct: 40 GNTNRRTRIQAKPALNLPSP 59 >SB_9298| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1514 Score = 26.2 bits (55), Expect = 9.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 291 LRVRIPLLLCASFLHKSPSVPYRPSRPDGGAFPR 190 L+ R+ L LC + + +S V Y GG F R Sbjct: 1128 LKTRLDLWLCGTIIQQSGPVSYVVKLSSGGVFRR 1161 >SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24) Length = 270 Score = 26.2 bits (55), Expect = 9.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 179 VPLDRGKAPPSGRDGRYGTEGLLCRNEAQSKRG 277 +P G+A P G G G G++ N A K+G Sbjct: 93 LPGPLGEAGPPGSQGSPGAPGIIGMNGAMGKKG 125 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 26.2 bits (55), Expect = 9.3 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 252 LHKSPSVPYRPSRPDGGAFPRSRGTRREEQ 163 +++ PS RP P+G P G REE+ Sbjct: 1 MNRGPSFANRPPGPEGYRRPSHEGASREER 30 >SB_15747| Best HMM Match : Ribosomal_L17 (HMM E-Value=2.5) Length = 167 Score = 26.2 bits (55), Expect = 9.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 249 HKSPSVPYRPSRPDGGAFPRSRGTRREEQHLLR 151 H S Y+ PD A+ R + T+R Q LLR Sbjct: 15 HYSVKTGYKRITPDKAAYTRIKPTKRVTQALLR 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,541,350 Number of Sequences: 59808 Number of extensions: 308740 Number of successful extensions: 904 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 904 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 669365910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -