BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20087 (558 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U09411-1|AAC50252.1| 589|Homo sapiens zinc finger protein ZNF13... 29 8.4 BC109108-1|AAI09109.1| 706|Homo sapiens zinc finger protein 132... 29 8.4 BC109107-1|AAI09108.1| 706|Homo sapiens zinc finger protein 132... 29 8.4 >U09411-1|AAC50252.1| 589|Homo sapiens zinc finger protein ZNF132 protein. Length = 589 Score = 29.5 bits (63), Expect = 8.4 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +2 Query: 182 GHLNSNRMVPIKHHMIESSSAGNVSNECGRADQRRCQYICSW 307 G S + IKH + + +ECG+ R+ IC W Sbjct: 460 GKFFSQNSILIKHQKVHTGEKPYKCSECGKFFSRKSSLICHW 501 >BC109108-1|AAI09109.1| 706|Homo sapiens zinc finger protein 132 protein. Length = 706 Score = 29.5 bits (63), Expect = 8.4 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +2 Query: 182 GHLNSNRMVPIKHHMIESSSAGNVSNECGRADQRRCQYICSW 307 G S + IKH + + +ECG+ R+ IC W Sbjct: 577 GKFFSQNSILIKHQKVHTGEKPYKCSECGKFFSRKSSLICHW 618 >BC109107-1|AAI09108.1| 706|Homo sapiens zinc finger protein 132 protein. Length = 706 Score = 29.5 bits (63), Expect = 8.4 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +2 Query: 182 GHLNSNRMVPIKHHMIESSSAGNVSNECGRADQRRCQYICSW 307 G S + IKH + + +ECG+ R+ IC W Sbjct: 577 GKFFSQNSILIKHQKVHTGEKPYKCSECGKFFSRKSSLICHW 618 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,600,994 Number of Sequences: 237096 Number of extensions: 1523587 Number of successful extensions: 3223 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3221 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5590411794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -