BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20086X (334 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 2.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 3.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 3.9 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 5.2 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 5.2 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 5.2 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 5.2 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 5.2 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 5.2 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 5.2 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 5.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 5.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 5.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 5.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 5.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 5.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 5.2 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 20 6.8 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 2.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 K R R R R + ++PSHY+ Sbjct: 297 KERSRDRRERGRSREHRIIPSHYI 320 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 3.9 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 312 RERSRDRRGRGRSREHRIIPSHYI 335 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 3.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 219 LAQFATRPDLGGECLKNILRR 157 L +F+T GG+ L+ +L+R Sbjct: 724 LVRFSTLEGSGGDSLRTLLQR 744 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 64 RERSRDRRERGRSREHRIIPSHYI 87 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 64 RERSRDRRERGRSREHRIIPSHYI 87 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 64 RERSRDRRERGRSREHRIIPSHYI 87 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 64 RERSRDRRERGRSREHRIIPSHYI 87 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 64 RERSRDRRERGRSREHRIIPSHYI 87 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 64 RERSRDRRERGRSREHRIIPSHYI 87 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 64 RERSRDRRERGRSREHRIIPSHYI 87 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 313 RERSRDRRERGRSREHRIIPSHYI 336 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 313 RERSRDRRERGRSREHRIIPSHYI 336 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 313 RERSRDRRERGRSREHRIIPSHYI 336 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 313 RERSRDRRERGRSREHRIIPSHYI 336 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 313 RERSRDRRERGRSREHRIIPSHYI 336 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 313 RERSRDRRERGRSREHRIIPSHYI 336 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 5.2 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +1 Query: 253 KSRYRGRSARYATDAPTLLPSHYV 324 + R R R R + ++PSHY+ Sbjct: 313 RERSRDRRERGRSREHRIIPSHYI 336 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 20.2 bits (40), Expect = 6.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 278 ADRPR*RDLQSENSQRLSSILLNSPRVRTSV 186 A RP+ LQS+ +Q + + R+R ++ Sbjct: 324 AGRPQNLQLQSQRNQLIQYVATLEKRLRDAI 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,195 Number of Sequences: 438 Number of extensions: 1768 Number of successful extensions: 18 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7466580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -