BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20084 (727 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9409| Best HMM Match : HLH (HMM E-Value=5.8e-17) 30 1.7 SB_28123| Best HMM Match : zf-NF-X1 (HMM E-Value=0.24) 30 2.2 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 29 5.1 SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_9409| Best HMM Match : HLH (HMM E-Value=5.8e-17) Length = 362 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = -3 Query: 593 TLLTPKAIWSPFQLVPTPNTKYWLRSVFRS*SRPCCSPTERLTSS 459 T P IW F+L+PTP RS RS PC SP ++SS Sbjct: 33 TATVPMDIWKKFELLPTPP-----RSPSRS---PCDSPVHMISSS 69 >SB_28123| Best HMM Match : zf-NF-X1 (HMM E-Value=0.24) Length = 453 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +3 Query: 186 KKSEVITNVVNKLIRNNKMNCMETPINFGSRAPRTSSGIVSQLSSD 323 K+ ++TN+ + I N++N + INF R S + +++SSD Sbjct: 214 KEKMILTNLKSPRITANQLNVYKNQINFLKRMFELQSALEAEVSSD 259 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 28.7 bits (61), Expect = 5.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 439 QDKPESQLEVNRSVGEQQGLLQDLNTERNQY 531 + KP S NR+ G ++G +QD +R Y Sbjct: 354 ESKPSSSSSKNRNTGLERGRVQDFGRDRRDY 384 >SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 588 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +1 Query: 79 QIPTSLTTFWRSSFTIASSSPITTVRLKRASIYTRRRRAKSSQM 210 +IPTS R SFTI P + VR R S +T RR +S++ Sbjct: 403 RIPTSRVRQTRLSFTIVRRIPTSRVRQTRLS-FTMIRRIPASRV 445 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,293,598 Number of Sequences: 59808 Number of extensions: 396993 Number of successful extensions: 1151 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1151 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -