BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20084 (727 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 25 3.2 AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 5.5 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 23 7.3 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 7.3 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 23 9.6 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 9.6 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 392 DVQGDDGRPAYGDGKDKTSPRV 457 D GD GRPAY D + +V Sbjct: 101 DRNGDGGRPAYSGNSDPSMDQV 122 >AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 97 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 135 >AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 97 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 135 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 98 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 136 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 97 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 135 >AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 97 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 135 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 81 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 119 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 409 IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD 293 +V + + S T AL H L +V G+D + +P+ Sbjct: 111 VVRRQLTMKNHSATHALNHSLLKVLGQDTDQRGSLVVPE 149 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.4 bits (48), Expect = 7.3 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 4/30 (13%) Frame = -3 Query: 314 QLGNNP----GRCPWSPGAKVDRRLHAVHL 237 Q+GN P CP + G K D R+H +L Sbjct: 291 QVGNKPVFQCKLCPTTCGRKTDLRIHVQNL 320 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.4 bits (48), Expect = 7.3 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 466 LPADSRACLVLAVAVGRSAIVALNIIAQ 383 LP DS L L V + S V LN++A+ Sbjct: 255 LPPDSGEKLTLGVTILLSLTVFLNLVAE 282 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.0 bits (47), Expect = 9.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 274 PGLQGHRPGLFPS 312 PGL+G RP FP+ Sbjct: 35 PGLEGRRPVTFPN 47 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 539 WESALTGTATIWPS 580 W S TGTA IW S Sbjct: 45 WVSDSTGTAAIWAS 58 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 663,956 Number of Sequences: 2352 Number of extensions: 12820 Number of successful extensions: 93 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -