BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20084 (727 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46934-11|CAE18043.1| 497|Caenorhabditis elegans Hypothetical p... 30 1.5 Z46934-10|CAD18882.1| 495|Caenorhabditis elegans Hypothetical p... 30 1.5 Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical pr... 29 4.5 U13019-4|AAC24451.1| 222|Caenorhabditis elegans Hypothetical pr... 29 4.5 U13019-3|AAC24452.2| 713|Caenorhabditis elegans Hypothetical pr... 29 4.5 U41508-1|AAG00027.3| 944|Caenorhabditis elegans Set (trithorax/... 28 5.9 L12018-1|AAA65458.1| 518|Caenorhabditis elegans Polk (dna polym... 28 5.9 Z19153-3|CAA79547.1| 301|Caenorhabditis elegans Hypothetical pr... 28 7.8 U39744-3|AAK18884.2| 563|Caenorhabditis elegans Hypothetical pr... 28 7.8 >Z46934-11|CAE18043.1| 497|Caenorhabditis elegans Hypothetical protein ZK1320.12b protein. Length = 497 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 141 DYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCM 251 D D + EK + +KK IT++VN +IRN C+ Sbjct: 205 DIDFSYEKVREAMSQKKRNGITSLVNYMIRNYPSICL 241 >Z46934-10|CAD18882.1| 495|Caenorhabditis elegans Hypothetical protein ZK1320.12a protein. Length = 495 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 141 DYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCM 251 D D + EK + +KK IT++VN +IRN C+ Sbjct: 205 DIDFSYEKVREAMSQKKRNGITSLVNYMIRNYPSICL 241 >Z50071-1|CAA90408.1| 1022|Caenorhabditis elegans Hypothetical protein T07D4.4a protein. Length = 1022 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +3 Query: 267 FGSRAPRTSSGIVSQLSSDL--SSPKTRLSLCTSATVS 374 FG APRT SG + Q S++L S+PKT A++S Sbjct: 145 FGVLAPRTLSGSIPQTSTNLEDSTPKTSTGGRFGASIS 182 >U13019-4|AAC24451.1| 222|Caenorhabditis elegans Hypothetical protein T12A2.15b protein. Length = 222 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +2 Query: 428 DGKDKTSPRVSWKLIALWENNKVYFKI*TLNVTNT 532 D KD+ +P VS KL+AL + NK FK T NT Sbjct: 120 DKKDQCNPYVSVKLVAL-DGNKEVFKKKTPTAKNT 153 >U13019-3|AAC24452.2| 713|Caenorhabditis elegans Hypothetical protein T12A2.15a protein. Length = 713 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +2 Query: 428 DGKDKTSPRVSWKLIALWENNKVYFKI*TLNVTNT 532 D KD+ +P VS KL+AL + NK FK T NT Sbjct: 611 DKKDQCNPYVSVKLVAL-DGNKEVFKKKTPTAKNT 644 >U41508-1|AAG00027.3| 944|Caenorhabditis elegans Set (trithorax/polycomb) domaincontaining protein 19 protein. Length = 944 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 3/65 (4%) Frame = +3 Query: 138 ADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMETPINFGSRA---PRTSSGIVS 308 +DY S + +E T +NK++ N + +E+P G+R PRT I + Sbjct: 756 SDYSSVLNSPASTSQESTGMRDTQRLNKVLSKNNIGELESPRLNGTRVLSPPRTRHQISN 815 Query: 309 QLSSD 323 + SD Sbjct: 816 AIDSD 820 >L12018-1|AAA65458.1| 518|Caenorhabditis elegans Polk (dna polymerase kappa) homologprotein 1 protein. Length = 518 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +2 Query: 179 RGEEERSHHKCREQTDTK---QQDELHGDAYQLWLQGSKDIVRDCFPVEFRLIFA 334 R EE+ K R QT T+ Q+ E+ + ++ L+ S+D+ RDC ++ FA Sbjct: 41 RIEEKVLEIKNRLQTATREERQKSEILMENLEMKLESSRDLSRDCVCIDMDAYFA 95 >Z19153-3|CAA79547.1| 301|Caenorhabditis elegans Hypothetical protein C38C10.3 protein. Length = 301 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +3 Query: 279 APRTSSGIVSQLSSDLSSPKTRLSLCTSATVS 374 A + SSG+VSQ+SS SS + R +L ++ S Sbjct: 91 AVKNSSGLVSQISSTTSSERKRRTLARPSSSS 122 >U39744-3|AAK18884.2| 563|Caenorhabditis elegans Hypothetical protein C03F11.3 protein. Length = 563 Score = 27.9 bits (59), Expect = 7.8 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = -1 Query: 286 LGALEPKLIGVSMQFILLFRISLFTTFVMTSLFFSSYK 173 LGAL +G I LF +S FTT + L FS YK Sbjct: 194 LGALIEGELGT---LISLFNVSPFTTVTVDQLLFSGYK 228 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,766,114 Number of Sequences: 27780 Number of extensions: 284778 Number of successful extensions: 982 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1708383636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -