BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20080 (737 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 26 1.1 AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 pr... 25 2.4 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 2.4 AY330178-1|AAQ16284.1| 176|Anopheles gambiae odorant-binding pr... 25 3.2 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 23 7.4 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 23 9.8 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 9.8 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 26.2 bits (55), Expect = 1.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 317 FSII*YIRQCSRPCPGHVLVYYEAYSRSTHP 225 F +I Q C H+ Y EAY R+THP Sbjct: 397 FDVILDENQLEEAC-NHLAEYLEAYWRATHP 426 >AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 25.0 bits (52), Expect = 2.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 Query: 174 KTTADCSLGGRDSGKPNFVLMQLHW*H 94 +T ADCSLGG K VL+ L H Sbjct: 20 RTLADCSLGGYRVPKDTTVLIGLRTVH 46 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 206 NLTDHILDVCYENRPRNT 259 N TD+++DV Y +R RNT Sbjct: 416 NRTDNVIDVKYYSRCRNT 433 >AY330178-1|AAQ16284.1| 176|Anopheles gambiae odorant-binding protein AgamOBP51 protein. Length = 176 Score = 24.6 bits (51), Expect = 3.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 292 CLMYQMIENCPEESLRKDDVCSPVSS 369 C+M + + NCP E +C V S Sbjct: 144 CIMVESMRNCPAERWDSSVLCEKVRS 169 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 23.4 bits (48), Expect = 7.4 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +3 Query: 21 GYFSYLIWHWCK 56 G Y+IW WC+ Sbjct: 173 GMIDYMIWPWCE 184 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 645 NVVRLPEVQTPDVDITNLDPLDCCD 719 NVV L ++ + VD+ L P+ CD Sbjct: 367 NVVELLDLYSTLVDLAGLPPVPRCD 391 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +3 Query: 27 FSYLIWHWCKLSSAHLT*ENLDCVTNGVALIRSWVFRSLCLPENSLL 167 F Y I HW + ++ H+ + CV +FR L ENS++ Sbjct: 438 FEYAIGHWLQKATEHV----IGCVLCSPGCFS--LFRGRALMENSVM 478 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 867,877 Number of Sequences: 2352 Number of extensions: 19738 Number of successful extensions: 41 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -