BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20074 (638 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY907825-1|AAX92637.1| 67|Anopheles gambiae antimicrobial pept... 24 3.5 DQ007318-1|AAY24700.1| 153|Anopheles gambiae lysozyme c-4 protein. 23 6.2 AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. 23 8.2 >AY907825-1|AAX92637.1| 67|Anopheles gambiae antimicrobial peptide defensin 3 protein. Length = 67 Score = 24.2 bits (50), Expect = 3.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 192 IVSVGTSVLKNLELSWTLGPKMYHKLCGKI 281 +V+VG + LKNL GPK + C + Sbjct: 16 LVAVGEAQLKNLACVTNEGPKWANTYCAAV 45 >DQ007318-1|AAY24700.1| 153|Anopheles gambiae lysozyme c-4 protein. Length = 153 Score = 23.4 bits (48), Expect = 6.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 291 FTINNK*ICTDARKGGRNALMCK 359 F IN+K C + RKGG C+ Sbjct: 85 FQINSKTWCREGRKGGHCDKKCE 107 >AM182454-1|CAJ65692.1| 182|Anopheles gambiae globin 2 protein. Length = 182 Score = 23.0 bits (47), Expect = 8.2 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 147 KKNKRHSSKHRYTNLIVSVGTSVLKNLELSWTLGPKMYHKL 269 K +RH + YT I+++G +L LE + LG +M L Sbjct: 95 KITRRHKDRPVYTEDILTIGEVLLNYLEQA--LGRQMSDSL 133 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,078 Number of Sequences: 2352 Number of extensions: 13666 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -