BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20072 (789 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC27B12.09c |||FAD transporter|Schizosaccharomyces pombe|chr 2... 26 5.4 SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosa... 26 7.1 >SPBC27B12.09c |||FAD transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 277 Score = 26.2 bits (55), Expect = 5.4 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 169 LYCSYEINSVVSVCK-GQLYCIFVFSRAVSSSIFRWANVERSVRSFRPTYRWTGC 8 LY IN + S G +CI+ FS+ V S+ + N E SV + + GC Sbjct: 56 LYHGLSINVLGSAASWGAYFCIYDFSKRVVMSMTPFNNGEISVLQTLCSSGFAGC 110 >SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosaccharomyces pombe|chr 1|||Manual Length = 1162 Score = 25.8 bits (54), Expect = 7.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 296 EFKDISTPVITCIMPGYSFPGREL 225 +F DIS+P + I P YSF + L Sbjct: 334 DFSDISSPSVMNIHPLYSFSSKSL 357 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,188,471 Number of Sequences: 5004 Number of extensions: 65943 Number of successful extensions: 150 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 383374054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -