BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20072 (789 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK124283-1|BAC85825.1| 306|Homo sapiens protein ( Homo sapiens ... 30 8.3 >AK124283-1|BAC85825.1| 306|Homo sapiens protein ( Homo sapiens cDNA FLJ42289 fis, clone TLIVE2006529. ). Length = 306 Score = 30.3 bits (65), Expect = 8.3 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -1 Query: 765 SISRRHLRRRCLWLQ*PLNTRWAVSSPTHISIKKMTF 655 SIS+R L R LW Q L + W VS+ T I +TF Sbjct: 212 SISKRGLLARRLWAQPMLLSGWVVSTTTTIITVTVTF 248 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,787,609 Number of Sequences: 237096 Number of extensions: 2089017 Number of successful extensions: 3260 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3260 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9646050614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -