BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20070 (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53664| Best HMM Match : PARP_reg (HMM E-Value=0) 66 2e-11 SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35) 38 0.010 SB_57704| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 28 8.0 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 28 8.0 >SB_53664| Best HMM Match : PARP_reg (HMM E-Value=0) Length = 834 Score = 66.5 bits (155), Expect = 2e-11 Identities = 28/60 (46%), Positives = 40/60 (66%) Frame = +3 Query: 45 DFKVEYSKSSRATCPECEIKICKDEIRICKILYDTEVGMKYGGQPRWHHLPCFVKCRNEL 224 D EY+KSSR+TC C+ +I K E+R+ K++ G KYG P+WHH+PCF+K +L Sbjct: 127 DLLAEYAKSSRSTCKHCDEQIVKGELRLAKVM----DGEKYGPVPKWHHVPCFLKAMPDL 182 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/54 (35%), Positives = 29/54 (53%) Frame = +3 Query: 48 FKVEYSKSSRATCPECEIKICKDEIRICKILYDTEVGMKYGGQPRWHHLPCFVK 209 FK EY+KS+R++C C+ I KD +R+ +++ P W H CF K Sbjct: 33 FKTEYAKSNRSSCKSCKSNIGKDSLRVARMVQ----------VPNWFHFSCFFK 76 >SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35) Length = 1311 Score = 37.5 bits (83), Expect = 0.010 Identities = 20/54 (37%), Positives = 26/54 (48%) Frame = +3 Query: 39 LKDFKVEYSKSSRATCPECEIKICKDEIRICKILYDTEVGMKYGGQPRWHHLPC 200 LK F VEY+ RA C C+ +I K RI K L G +W+H+ C Sbjct: 9 LKSFLVEYAPQGRAKCKGCKEQIEKSSARIAK-LAPNPFSEDGGLMKQWYHVKC 61 >SB_57704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 250 RFSPPAKYRSSFLHLTKQGKWCHLGCP 170 R PP + R F+H + G CH+G P Sbjct: 120 RLRPPLRTRD-FIHQMRHGMLCHVGAP 145 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 27.9 bits (59), Expect = 8.0 Identities = 9/24 (37%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -3 Query: 226 RSSFLHLTKQGKWCHLGCPP-YFI 158 ++ + +L K G++CH CP YF+ Sbjct: 484 KNGYYYLEKDGRFCHKSCPKGYFV 507 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 27.9 bits (59), Expect = 8.0 Identities = 9/24 (37%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -3 Query: 226 RSSFLHLTKQGKWCHLGCPP-YFI 158 ++ + +L K G++CH CP YF+ Sbjct: 133 KNGYYYLEKDGRFCHKSCPKGYFV 156 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,736,820 Number of Sequences: 59808 Number of extensions: 357021 Number of successful extensions: 987 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 985 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -