Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20069
         (312 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A6RLT2 Cluster: Putative uncharacterized protein; n=2; ...    31   5.0  

>UniRef50_A6RLT2 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 1364

 Score = 31.1 bits (67), Expect = 5.0
 Identities = 17/40 (42%), Positives = 27/40 (67%), Gaps = 4/40 (10%)
 Frame = +3

Query: 90  AISKNSL*PG--VMGVGSK*PE--TFLLAYRFVITQVTML 197
           AIS++SL PG  +   G+K  +  TF + + F++TQ+TML
Sbjct: 484 AISRDSLLPGFSIFSQGTKKADEPTFAIVFTFIVTQLTML 523


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 266,159,695
Number of Sequences: 1657284
Number of extensions: 4027349
Number of successful extensions: 6427
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6376
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6426
length of database: 575,637,011
effective HSP length: 80
effective length of database: 443,054,291
effective search space used: 10190248693
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)