Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20069
         (312 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g39820.1 68415.m04891 eukaryotic translation initiation facto...    25   8.1  

>At2g39820.1 68415.m04891 eukaryotic translation initiation factor
          6, putative / eIF-6, putative similar to SP|O55135
          Eukaryotic translation initiation factor 6 (eIF-6) (B4
          integrin interactor) {Mus musculus}; contains Pfam
          profile PF01912: eIF-6 family
          Length = 247

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%)
 Frame = -1

Query: 87 MMKELKSTSNKSLLSVFSKLTN--CIISPSS 1
          M   L+  +N   + VFSKLTN  C++S +S
Sbjct: 1  MATRLQYDNNNCEIGVFSKLTNAYCLVSATS 31


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 5,774,140
Number of Sequences: 28952
Number of extensions: 90524
Number of successful extensions: 133
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 132
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 133
length of database: 12,070,560
effective HSP length: 70
effective length of database: 10,043,920
effective search space used: 331449360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)