BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20066 (744 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 33 0.15 At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase f... 31 1.1 At5g43900.1 68418.m05368 myosin heavy chain (MYA2) nearly identi... 29 3.3 At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identica... 29 3.3 At5g56690.1 68418.m07076 F-box family protein contains F-box dom... 29 4.3 At4g12900.1 68417.m02018 gamma interferon responsive lysosomal t... 27 9.9 At1g59453.1 68414.m06679 transcription factor-related weak simil... 27 9.9 At1g59077.1 68414.m06670 hypothetical protein 27 9.9 At1g58766.1 68414.m06659 hypothetical protein 27 9.9 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 27 9.9 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 33.5 bits (73), Expect = 0.15 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +2 Query: 5 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKK 184 +D + P+ +I+ + V +L S +P D+L++ L D DSA +K E K Sbjct: 154 VDLADLLPSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKM 213 Query: 185 SEVITNV 205 + N+ Sbjct: 214 GSIAPNL 220 >At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase family protein contains Pfam profile PF01812 5-formyltetrahydrofolate cyclo-ligase Length = 354 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 275 PRTSSGIVSQLSSDLSSPKTRLSLCTSATVS 367 PR +G S L SDL P+T + CTS V+ Sbjct: 171 PRLRTGFFSVLESDLLKPETIMEACTSVGVA 201 >At5g43900.1 68418.m05368 myosin heavy chain (MYA2) nearly identical to PIR|S51824 myosin heavy chain MYA2 [Arabidopsis thaliana] Length = 1505 Score = 29.1 bits (62), Expect = 3.3 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 1/79 (1%) Frame = -1 Query: 408 SAIVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPDDVLGALEPKLKAYSMQFIL 229 S +++L I A R S+ L + R FG+D ++W++I D L +L LK + +L Sbjct: 1269 STLLSLCIQAPRSSKGGML--RSGRSFGKDSPAVHWQSIIDG-LNSLLVTLKENHVPLVL 1325 Query: 228 LFRI-SLFTTFVMTSLFFS 175 + +I S +++ LF S Sbjct: 1326 IQKIYSQTFSYINVQLFNS 1344 >At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identical to Anthocyaninless2 [Arabidopsis thaliana] GI:5702094 Length = 802 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 507 HERNQYLVLGVGTNWNGDHMAF 572 H N L L VGTN NG H AF Sbjct: 271 HHYNSSLELAVGTNNNGGHFAF 292 >At5g56690.1 68418.m07076 F-box family protein contains F-box domain Pfam:PF00646 Length = 402 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 519 QYLVLGVGTNWNGDHMAFGVNSVDSFRAQWYLQPAKYDNDVLFYIY 656 +YL + N F +NS+++FR +WY + D D L I+ Sbjct: 344 EYLPVSWSKNQGSVPKCF-LNSLETFRVKWYYSEEQEDRDFLSLIF 388 >At4g12900.1 68417.m02018 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 231 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 463 IALWENNKVYFKILNMNVTNTWYWESAL 546 I W N ++++K + TNT WES + Sbjct: 107 IRTWPNQRLHYKFIRCVETNTNAWESCV 134 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 98 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 205 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 1545 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 1581 >At1g59077.1 68414.m06670 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 98 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 205 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g58766.1 68414.m06659 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 98 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 205 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 27.5 bits (58), Expect = 9.9 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +3 Query: 51 SWHLCMLQIPTSLTTFWRSSFTIASSSPITTV 146 +W + +L +P ++ FW + +ASS + + Sbjct: 1086 TWQVFLLVVPVAVACFWMQKYYMASSRELVRI 1117 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,544,016 Number of Sequences: 28952 Number of extensions: 275156 Number of successful extensions: 1064 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1030 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1064 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -