BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20065 (681 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 25 0.76 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 4.0 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 9.3 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 24.6 bits (51), Expect = 0.76 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 7/53 (13%) Frame = +2 Query: 350 RQPSNRIGVGSLYGLMVFCTS----KLEVCYIEANGFYLGKLRGL---LGDGN 487 R+P NRI + G +V C++ ++ ++ ++G +G + GL L +GN Sbjct: 27 REPPNRIDFSNTTGAVVECSAHGNPTPDIIWVRSDGTAVGDVPGLRQVLANGN 79 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.2 bits (45), Expect = 4.0 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +2 Query: 215 FKTENPRLLFWKIKRSIIE 271 +K ENP + W+I+ +++ Sbjct: 124 YKRENPSIFSWEIRDRLVK 142 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 35 RAYRPRSINPLDECRLSSALLL 100 R ++ S N L+ CR + ALLL Sbjct: 86 RFHQGASYNTLNTCRSALALLL 107 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,209 Number of Sequences: 336 Number of extensions: 3185 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -