BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20064 (796 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0614 - 5069976-5070479 28 9.8 01_06_0106 - 26516930-26517349,26517474-26517905,26517981-265180... 28 9.8 >12_01_0614 - 5069976-5070479 Length = 167 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 698 VYLLFVSTPTKASNNSTF*CIISWSIMERYSKPRGQL 588 V L+ +TP AS N T ++ ++ERY PRG L Sbjct: 18 VVLVVAATPAAASGNGTS-TPTAYEMLERYDFPRGIL 53 >01_06_0106 - 26516930-26517349,26517474-26517905,26517981-26518058, 26518352-26518499,26518662-26518765,26518838-26518912, 26519195-26519261,26519352-26519356 Length = 442 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 276 LSMKSIKRSYCRLYKRVFKSNHCGYE-RLLTEEEKRFSCSIDKYSIV 413 + K ++ YC + K V K CG R + F+C D+Y +V Sbjct: 263 IGKKEVEDKYCLIAKDVVKLKKCGNGWRGAEDGRSNFACLEDEYCLV 309 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,867,424 Number of Sequences: 37544 Number of extensions: 324968 Number of successful extensions: 674 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -