BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20064 (796 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 27 0.88 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 24 6.2 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.6 bits (56), Expect = 0.88 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +1 Query: 580 SLSNCPRGLEYLSMIDQ--LIMHQKVELLEAFVG 675 S CP+GLE L + D L++ K + L F G Sbjct: 132 SSRTCPKGLELLQLADNLGLVLLNKADCLPTFKG 165 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.8 bits (49), Expect = 6.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 786 KGRKGPQQFLCSNHYPQ 736 +G PQ+F+C H PQ Sbjct: 261 RGLFSPQKFVCHQHEPQ 277 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 756,526 Number of Sequences: 2352 Number of extensions: 14727 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83576403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -