BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20061 (772 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22E12.01 ||SPAC890.09|triose phosphate transporter |Schizosa... 30 0.42 SPAC12G12.04 |hsp60|hsp60|mitochondrial heat shock protein Hsp60... 29 0.74 SPBP23A10.14c |ell1||RNA polymerase II transcription elongation ... 27 2.2 SPAC25B8.12c |||nucleotide-sugar phosphatase |Schizosaccharomyce... 27 2.2 SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosacch... 27 3.0 SPAC4G9.04c |||cleavage and polyadenylation specificity factor |... 27 3.9 SPAC3H8.08c |||transcription factor|Schizosaccharomyces pombe|ch... 26 5.2 SPBC2G2.13c |||deoxycytidylate deaminase |Schizosaccharomyces po... 26 5.2 SPCC364.07 ||SPCC4G3.01|D-3 phosphoglycerate dehydrogenase |Schi... 26 6.9 SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||M... 26 6.9 SPAC25B8.14 |mal2||kinetochore protein Mal2 |Schizosaccharomyces... 25 9.1 SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pomb... 25 9.1 SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|... 25 9.1 SPAC27E2.06c |||methionine-tRNA ligase, mitochondrial|Schizosacc... 25 9.1 >SPAC22E12.01 ||SPAC890.09|triose phosphate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 374 Score = 29.9 bits (64), Expect = 0.42 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +1 Query: 655 VLPNVNSTI-YHDVPAIINLVDYV----NVGAYDYYTPTRNTKK 771 ++ + ST+ YHD+ IN+V V +G Y+YY T+ KK Sbjct: 316 IITIIASTLFYHDILLPINIVGLVITLCGIGVYNYYRITKGNKK 359 >SPAC12G12.04 |hsp60|hsp60|mitochondrial heat shock protein Hsp60|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 29.1 bits (62), Expect = 0.74 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 296 AKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGVL 424 AK G ++ VGG ++ E EK + ++++ A A ++ GVL Sbjct: 402 AKLSGGIAVIKVGGSSEVEVNEKKDRIVDALNAVKAAVSEGVL 444 >SPBP23A10.14c |ell1||RNA polymerase II transcription elongation factor SpELL|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 27.5 bits (58), Expect = 2.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 399 LLSLIPECCWLNNMVSMELTSP 464 L +L+PE W NNM EL +P Sbjct: 227 LQALLPEVAWKNNMNQWELLNP 248 >SPAC25B8.12c |||nucleotide-sugar phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 303 Score = 27.5 bits (58), Expect = 2.2 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 251 HNRTH-DNYRAITSLKAKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSGVL 424 H+R H YRA+ ++ KYP ++L+ G + + L L++ A A +N VL Sbjct: 31 HHRFHFRTYRAMKYIREKYPNFPIVLATGKQRSAVDLIRIPLDLDAFPA--AHVNGCVL 87 >SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 27.1 bits (57), Expect = 3.0 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -1 Query: 196 SRTASGCRTTERDRGPTAACGLEIL*HSSCCRSNKVLCC 80 S+ GC +TE+ T+ C E SCC S K CC Sbjct: 257 SQEKKGCCSTEK----TSCCSQE---KKSCCTSEKPSCC 288 >SPAC4G9.04c |||cleavage and polyadenylation specificity factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 26.6 bits (56), Expect = 3.9 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -2 Query: 462 ARSIPSKPYC--SANSTPELMKAVRACCDSSRRLYFSGSSVSASPPTDNNTVRPG 304 A S PS P S +STP + ++ + + Y +SVS+ PP ++ V PG Sbjct: 277 ATSAPSVPSALSSISSTPFMKPSIPSTIPTIPSAY--SASVSSQPPLTHSYVHPG 329 >SPAC3H8.08c |||transcription factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 563 Score = 26.2 bits (55), Expect = 5.2 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 642 LHLRLVDKGLFQFTNKGSETFTVLRFLLIDWRGAECLLNSMP 517 +H+ + LFQ T K + + L F L + G EC+L P Sbjct: 271 IHVSTLVTPLFQVTEKIGKNTSDLWFALCEIDGLECVLKYRP 312 >SPBC2G2.13c |||deoxycytidylate deaminase |Schizosaccharomyces pombe|chr 2|||Manual Length = 348 Score = 26.2 bits (55), Expect = 5.2 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 479 VKPKKIRSTWDRFGMELRRHSAPRQS-MRRNLSTVKV 586 + P + R +WD + ME+ +A R + M+R + V V Sbjct: 191 LNPNRFRPSWDSYFMEMASLAAKRSNCMKRRVGCVLV 227 >SPCC364.07 ||SPCC4G3.01|D-3 phosphoglycerate dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 466 Score = 25.8 bits (54), Expect = 6.9 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +2 Query: 248 GHNRTHDNYRAITSLKAKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFINSG 418 G ++ D+ + TS + + +GG TEE + YN+ +E +A T +IN G Sbjct: 318 GKDKFVDSLNSWTSELTHCKNIILTPHIGGS--TEEAQ-YNIGIEVSEALTRYINEG 371 >SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1258 Score = 25.8 bits (54), Expect = 6.9 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 Query: 435 CSANSTPELMKAVRACCDSSRRLYFSGS 352 C NST + M V C D RLY G+ Sbjct: 652 CEFNSTRKRMSIVFRCPDGKIRLYVKGA 679 >SPAC25B8.14 |mal2||kinetochore protein Mal2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 303 Score = 25.4 bits (53), Expect = 9.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 378 WNRSKPVLLSLIPECCWLNNMVSMELTSPGSSQEL 482 W R + LSL+ W+N +VS LT+P S L Sbjct: 270 WKRDHRLELSLLDNKRWVNILVS-HLTAPESHASL 303 >SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1428 Score = 25.4 bits (53), Expect = 9.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 90 TLLLRQQELCQRISSPHAAVGPRSRSVVLHPLAV 191 TLL++Q+ LC S A+ S S V+ PL + Sbjct: 1045 TLLIKQENLCNNGSLLFEAIEQNSLSKVMIPLNI 1078 >SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 25.4 bits (53), Expect = 9.1 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 317 VLLSVGGDADTEEPEKYNLLLESQQARTAFINS 415 ++ VGG+AD + E +LL + +A +N+ Sbjct: 348 IVPQVGGEADVDPKEYMEMLLSTYKASKELVNT 380 >SPAC27E2.06c |||methionine-tRNA ligase, mitochondrial|Schizosaccharomyces pombe|chr 1|||Manual Length = 539 Score = 25.4 bits (53), Expect = 9.1 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 6/51 (11%) Frame = +1 Query: 589 TALVRELKQAL----IHKPKMQL--GVTVLPNVNSTIYHDVPAIINLVDYV 723 T ++ ELK + I +PK +L G+ V N TIY + A+IN + + Sbjct: 215 TQVLEELKTGISDLSISRPKQRLSWGIPVPGNSQQTIYVWLDALINYISVI 265 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,111,523 Number of Sequences: 5004 Number of extensions: 63077 Number of successful extensions: 189 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 188 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -