BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20058 (703 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1039.02 |||phosphoprotein phosphatase |Schizosaccharomyces p... 28 1.5 SPCC18B5.11c |cds1||replication checkpoint kinase Cds1|Schizosac... 26 4.5 SPAP27G11.15 |slx1||structure-specific endonuclease catalytic su... 26 4.5 SPAC16E8.02 |||DUF962 family protein|Schizosaccharomyces pombe|c... 26 6.0 >SPAC1039.02 |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 27.9 bits (59), Expect = 1.5 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 288 FASKSRDLRSIKGVELKMANKVYVHDGGKLDE 383 FA + ++L KGV+L M + +HDG L + Sbjct: 79 FALRMKELADFKGVDLLMVDTGDLHDGNGLSD 110 >SPCC18B5.11c |cds1||replication checkpoint kinase Cds1|Schizosaccharomyces pombe|chr 3|||Manual Length = 460 Score = 26.2 bits (55), Expect = 4.5 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -2 Query: 144 FHYFGKHSGCEVIVS---IFEYIREICDGCHCRDGDSKQTNDCLH 19 F FG+H CEV+++ + + EI G H D D + LH Sbjct: 59 FWRFGRHKSCEVVLNGPRVSNFHFEIYQG-HRNDSDESENVVFLH 102 >SPAP27G11.15 |slx1||structure-specific endonuclease catalytic subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 271 Score = 26.2 bits (55), Expect = 4.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 557 VNAIYFKGAWSSKFDERLTSDRDFYVSKDKTI 652 V+A+ F+ W + R T D DF K KTI Sbjct: 68 VSALKFEWNWQNLGISRYTKDCDFRSKKQKTI 99 >SPAC16E8.02 |||DUF962 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 222 Score = 25.8 bits (54), Expect = 6.0 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 699 LSPYL*SPRLYIMGTLIVLSLLT*KSRSLVSRSS 598 L L SP LY+ ++ L T SRSLV+RS+ Sbjct: 73 LDGLLYSPVLYLFSYILPSKLFTIFSRSLVNRSA 106 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,785,999 Number of Sequences: 5004 Number of extensions: 54970 Number of successful extensions: 162 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -