BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20053 (658 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A5.15c |||glutamate-tRNA ligase |Schizosaccharomyces pombe... 27 3.1 SPBC530.12c |pdf1||palmitoyl protein thioesterase-dolichol pyrop... 25 7.3 SPBC887.03c |noc3||Noc2p-Noc3p complex subunit Noc3 |Schizosacch... 25 7.3 >SPAC17A5.15c |||glutamate-tRNA ligase |Schizosaccharomyces pombe|chr 1|||Manual Length = 716 Score = 26.6 bits (56), Expect = 3.1 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -2 Query: 255 YLIIRGPCKTTVTI*WMQF*SARLDILKSILSRYSKI 145 Y++ +GP K +T+ W F + I+ + R++ + Sbjct: 483 YIVSQGPSKNILTLDWTSFWATNKKIIDPVAPRHTAV 519 >SPBC530.12c |pdf1||palmitoyl protein thioesterase-dolichol pyrophosphate phosphatase fusion 1|Schizosaccharomyces pombe|chr 2|||Manual Length = 603 Score = 25.4 bits (53), Expect = 7.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 112 FVSHLNNNVIISNYRRS 62 F++HLNN V+ NY R+ Sbjct: 192 FLTHLNNEVLHDNYTRN 208 >SPBC887.03c |noc3||Noc2p-Noc3p complex subunit Noc3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 747 Score = 25.4 bits (53), Expect = 7.3 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 195 SARLDILKSILSRYSKIN 142 SA L +LK +LSRYSK++ Sbjct: 672 SADLALLKKLLSRYSKLS 689 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,311,717 Number of Sequences: 5004 Number of extensions: 46193 Number of successful extensions: 115 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -