BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20049 (654 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.08 |||mitochondrial ribosomal small subunit|Schizosaccharo... 26 5.5 SPAC24H6.09 |gef1||RhoGEF Gef1|Schizosaccharomyces pombe|chr 1||... 25 9.5 >SPMIT.08 |||mitochondrial ribosomal small subunit|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 227 Score = 25.8 bits (54), Expect = 5.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 162 YQRSLLFSFYINLVIFRNYLLCSEIW 239 Y SL+FS YI ++I N + S +W Sbjct: 109 YGSSLIFSKYIAIIIGSNPKIASTLW 134 >SPAC24H6.09 |gef1||RhoGEF Gef1|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 25.0 bits (52), Expect = 9.5 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 390 KLQ*DANRFNYQRSLLFSFYIKISLLRNYLLCLEIWH 500 +L+ DA R N+QR +L F + ++L+ LE W+ Sbjct: 546 ELKTDA-RLNFQRQVLQDFRQRFAILKALHATLETWY 581 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,085,113 Number of Sequences: 5004 Number of extensions: 35452 Number of successful extensions: 47 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -