BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20049 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_34796| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 31.1 bits (67), Expect = 0.82 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 646 ITNIIGQDSFVKMITTIKINRWKFIVL 566 I N +G+D VK I +K +WK I+L Sbjct: 390 IPNFVGRDDLVKKIVKLKEEKWKLILL 416 >SB_34796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +3 Query: 369 Q*NYGTKKLQ*DANRFNYQRSLLFSFYIKISLLRNYLLCLEIWH 500 Q N ++L+ D N +QRS + +F + SL L C+++WH Sbjct: 43 QHNSDPRRLK-DPNVQRFQRSSVDTFLVSSSLCLGDLCCIKLWH 85 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,612,461 Number of Sequences: 59808 Number of extensions: 215286 Number of successful extensions: 249 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 249 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -