Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20049
         (654 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g51440.1 68416.m05634 strictosidine synthase family protein s...    28   4.7  

>At3g51440.1 68416.m05634 strictosidine synthase family protein
           similar to hemomucin [Drosophila
           melanogaster][GI:1280434], strictosidine synthase
           [Rauvolfia serpentina][SP|P15324]; contains
           strictosidine synthase domain PF03088
          Length = 371

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 14/49 (28%), Positives = 19/49 (38%)
 Frame = +3

Query: 117 NYGTKKLQ*DANRFNYQRSLLFSFYINLVIFRNYLLCSEIWHYLV*SID 263
           N G  ++  D N   Y      S     V   NYL C  +WH  +  +D
Sbjct: 312 NAGVLQVDLDGNPIAYYHDQALSHITTGVKIGNYLYCGSLWHSHILRLD 360


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,844,649
Number of Sequences: 28952
Number of extensions: 150915
Number of successful extensions: 208
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 167
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 208
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1363910256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)