BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20048 (727 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 24 5.5 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 23 7.3 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 9.6 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 9.6 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 23 9.6 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.8 bits (49), Expect = 5.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 57 TDGAFIIYCLWSIALNESV 1 T + YCL+ +ALNE++ Sbjct: 309 TSSTTMSYCLYELALNEAI 327 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 23.4 bits (48), Expect = 7.3 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = -2 Query: 519 RGSLNPGYLSYEVEIP-----TPKS---NPQNYNCVITGGRTSCESTRVG 394 +GS N GY P TP +PQ+YN + G TS S G Sbjct: 38 QGSQNDGYFPPSTYAPNIYPGTPHQAHYSPQSYNPLAGAGATSVNSASTG 87 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = -1 Query: 283 WRIHVVGVYCSSNHLTTTWAVSSSTHLNNYK 191 W++H VYC N L T + Y+ Sbjct: 684 WKVHPDWVYCEYNSLKDADGNGEGTEESTYR 714 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 66 VPITDGAFIIYCLWSIALNE 7 V I G +I LWSI++NE Sbjct: 383 VVIRKGTQVIIPLWSISMNE 402 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 23.0 bits (47), Expect = 9.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 337 TLQTETHDCFTAGIGIVLF 393 T E HD TAGI VLF Sbjct: 4 TFMFEGHDTTTAGISWVLF 22 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 823,598 Number of Sequences: 2352 Number of extensions: 19045 Number of successful extensions: 29 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -