BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20046 (678 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006720-1|AAF60446.1| 350|Caenorhabditis elegans Hypothetical ... 30 1.7 AF067621-1|AAC17540.2| 4368|Caenorhabditis elegans Hypothetical ... 28 5.3 >AC006720-1|AAF60446.1| 350|Caenorhabditis elegans Hypothetical protein Y17G9B.5 protein. Length = 350 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 2/31 (6%) Frame = -1 Query: 432 ATNKYRQQIYFVIKL--CNKYIENRLLEGKS 346 AT K ++ +Y++ KL NKY++ R +EGKS Sbjct: 149 ATKKVKRMLYWMPKLKHSNKYLDRRHVEGKS 179 >AF067621-1|AAC17540.2| 4368|Caenorhabditis elegans Hypothetical protein F55F10.1 protein. Length = 4368 Score = 28.3 bits (60), Expect = 5.3 Identities = 18/68 (26%), Positives = 30/68 (44%) Frame = -1 Query: 462 IVTIKY*QSAATNKYRQQIYFVIKLCNKYIENRLLEGKSDCCLLYLVYSRLGQIEANCAA 283 I T K S +TN YR+ + L R L ++ C +YL ++ L A + Sbjct: 2109 IETFKTSPSISTNAYREVCISISYLLLVAASRRKLTTRTGCAAIYLAWNDLKNEAAKTSG 2168 Query: 282 QNATEPVL 259 N ++ +L Sbjct: 2169 INCSKTLL 2176 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,707,230 Number of Sequences: 27780 Number of extensions: 289428 Number of successful extensions: 556 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -