BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20045X (339 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 32 0.11 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 32 0.11 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 0.45 At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN ... 28 1.8 At3g43890.1 68416.m04698 DC1 domain-containing protein contains ... 27 2.4 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 27 3.2 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 27 3.2 At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transfera... 27 3.2 At3g25590.1 68416.m03186 expressed protein 27 4.2 At5g10290.1 68418.m01194 leucine-rich repeat family protein / pr... 26 5.6 At4g02180.1 68417.m00290 DC1 domain-containing protein contains ... 26 5.6 At1g78570.1 68414.m09157 NAD-dependent epimerase/dehydratase fam... 26 5.6 At3g14790.1 68416.m01869 NAD-dependent epimerase/dehydratase fam... 26 7.4 At1g64530.1 68414.m07315 RWP-RK domain-containing protein simila... 26 7.4 At1g53500.1 68414.m06066 NAD-dependent epimerase/dehydratase fam... 26 7.4 At1g23770.1 68414.m02999 F-box family protein contains Pfam PF00... 26 7.4 At5g66720.2 68418.m08411 5-azacytidine resistance protein -relat... 25 9.7 At5g66720.1 68418.m08410 5-azacytidine resistance protein -relat... 25 9.7 At5g46130.1 68418.m05673 hypothetical protein contains Pfam prof... 25 9.7 At4g37690.1 68417.m05332 galactosyl transferase GMA12/MNN10 fami... 25 9.7 At4g17330.1 68417.m02600 agenet domain-containing protein contai... 25 9.7 At4g01930.1 68417.m00257 DC1 domain-containing protein contains ... 25 9.7 At1g67310.1 68414.m07661 calmodulin-binding protein similar to a... 25 9.7 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 31.9 bits (69), Expect = 0.11 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +1 Query: 82 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIENVVNNLIIDKRRN 252 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + +NV ++DK R Sbjct: 285 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRT 344 Query: 253 TWSTATSCG 279 + + S G Sbjct: 345 EQAGSFSRG 353 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 31.9 bits (69), Expect = 0.11 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +1 Query: 82 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIENVVNNLIIDKRRN 252 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + +NV ++DK R Sbjct: 286 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRT 345 Query: 253 TWSTATSCG 279 + + S G Sbjct: 346 EQAGSFSRG 354 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 0.45 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 55 MLAASAGVVELSADTSNQDLEEKLYNSILTGDYD 156 +LA + G ELS + Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSPSPAEQEIESFLYNAINMGFFD 103 >At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN protein (ETT) identical to ETTIN GB:AF007788 from [Arabidopsis thaliana] Length = 608 Score = 27.9 bits (59), Expect = 1.8 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = -1 Query: 300 NFLCRCRPTACSSTPCVPSLVNDQVVNYILDD--GXXXXXLIFQ-ALTDSTVVVAGEDAV 130 NF R P + SS+P L N N L+D G +F LTD T VA AV Sbjct: 511 NFSTRILPPSVSSSPSSVLLTNSNSPNGRLEDHHGGSGRCRLFGFPLTDETTAVASATAV 570 >At3g43890.1 68416.m04698 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 27.5 bits (58), Expect = 2.4 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +2 Query: 29 NFSLYLRCACSPPAR--ASLN---YPRTLLTKTSRRNCTT 133 NFSL L+C PP + LN +P TL+ K+ CTT Sbjct: 228 NFSLDLQCVFHPPKQNPHDLNIHDHPLTLMPKSISFTCTT 267 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 27.1 bits (57), Expect = 3.2 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 121 KLYNSILTGDYDSAVRQSLEYESQGKGSIIENVVNNLII 237 K+ + IL+G D A EY Q K I+N++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 27.1 bits (57), Expect = 3.2 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 121 KLYNSILTGDYDSAVRQSLEYESQGKGSIIENVVNNLII 237 K+ + IL+G D A EY Q K I+N++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 484 Score = 27.1 bits (57), Expect = 3.2 Identities = 15/64 (23%), Positives = 28/64 (43%) Frame = +1 Query: 130 NSILTGDYDSAVRQSLEYESQGKGSIIENVVNNLIIDKRRNTWSTATSCGSATAQEIVTK 309 N + TG+ + + + E ++GKG II ++I + T CG + E + Sbjct: 326 NQVGTGENEDWLPKGFEERNKGKGLIIRGWAPQVLILDHKAIGGFVTHCGWNSTLEGIAA 385 Query: 310 YFPL 321 P+ Sbjct: 386 GLPM 389 >At3g25590.1 68416.m03186 expressed protein Length = 423 Score = 26.6 bits (56), Expect = 4.2 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 303 NNFLCRCRPTACSSTPCVPSLVNDQVVNYILDD 205 + F CR P+ S P +ND++VN + + Sbjct: 25 SEFTCRKHPSVSSGVGICPYCLNDRLVNLVCSE 57 >At5g10290.1 68418.m01194 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 613 Score = 26.2 bits (55), Expect = 5.6 Identities = 14/61 (22%), Positives = 28/61 (45%) Frame = +1 Query: 121 KLYNSILTGDYDSAVRQSLEYESQGKGSIIENVVNNLIIDKRRNTWSTATSCGSATAQEI 300 K+Y +L + AV++ ++ES G + + V + + RN C + T + + Sbjct: 303 KVYKGVLPDNTKVAVKRLTDFESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTQTERLL 362 Query: 301 V 303 V Sbjct: 363 V 363 >At4g02180.1 68417.m00290 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 989 Score = 26.2 bits (55), Expect = 5.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 29 NFSLYLRCACSPPARASLN 85 NF+L LRC +PP ++ LN Sbjct: 252 NFTLDLRCVLNPPQQSLLN 270 Score = 26.2 bits (55), Expect = 5.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 Query: 29 NFSLYLRCACSPPARASLN 85 NF+L LRC +PP ++ LN Sbjct: 556 NFTLDLRCVLNPPPQSLLN 574 >At1g78570.1 68414.m09157 NAD-dependent epimerase/dehydratase family protein similar to dTDP-glucose 4,6-dehydratase from Aneurinibacillus thermoaerophilus GI:16357461, RmlB from Leptospira borgpetersenii GI:4234803; contains Pfam profile PF01370 NAD dependent epimerase/dehydratase family Length = 669 Score = 26.2 bits (55), Expect = 5.6 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 65 PARASLNYPRTLLTKTSRRNCTTASSPATTTVL 163 P + LN PR +TK SR N + P + TVL Sbjct: 541 PISSDLNNPRNFITKISRYN-KVVNIPNSMTVL 572 >At3g14790.1 68416.m01869 NAD-dependent epimerase/dehydratase family protein similar to dTDP-glucose 4,6-dehydratase from Aneurinibacillus thermoaerophilus GI:16357461, Saccharopolyspora spinosa GI:15077647, RmlB from Leptospira borgpetersenii GI:4234803; contains Pfam profile PF01370 NAD dependent epimerase/dehydratase family Length = 664 Score = 25.8 bits (54), Expect = 7.4 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 65 PARASLNYPRTLLTKTSRRNCTTASSPATTTVL 163 P + LN PR +TK SR N + P + T+L Sbjct: 536 PISSDLNNPRNFITKISRYN-KVVNIPNSMTIL 567 >At1g64530.1 68414.m07315 RWP-RK domain-containing protein similar to nodule inception protein [Lotus japonicus] GI:6448579; contains Pfam profile: PF02042 RWP-RK domain Length = 841 Score = 25.8 bits (54), Expect = 7.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 134 LLYSFSSRSWLEVSADSSTTPALAASMHIANTTR 33 L Y R W+ VS D+ + L S ANT R Sbjct: 784 LKYLDDDREWVSVSCDADLSECLDTSAAKANTLR 817 >At1g53500.1 68414.m06066 NAD-dependent epimerase/dehydratase family protein low similarity to dTDP-D-glucose-4,6-dehydratase from Aneurinibacillus thermoaerophilus GI:16357461, Sphingomonas sp. GI:1314581; contains Pfam profile PF01370: NAD dependent epimerase/dehydratase family; putative NDP-rhamnose synthase (rhm2 gene) GI:31559258 Length = 667 Score = 25.8 bits (54), Expect = 7.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 65 PARASLNYPRTLLTKTSRRNCTTASSPATTTVL 163 P + LN PR +TK SR N P + TVL Sbjct: 539 PISSDLNNPRNFITKISRYN-KVVDIPNSMTVL 570 >At1g23770.1 68414.m02999 F-box family protein contains Pfam PF00646: F-box domain; similar to F-box only protein 7 (SP:Q9Y3I1) {Homo sapiens} ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 350 Score = 25.8 bits (54), Expect = 7.4 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 104 LEVSADSSTTPALAASMHIANTTRSFILL 18 LE S D+S ALA S+H F+LL Sbjct: 54 LEKSGDTSDLTALALSVHAVMLESGFVLL 82 >At5g66720.2 68418.m08411 5-azacytidine resistance protein -related contains weak similarity to 5-azacytidine resistance protein azr1 (Swiss-Prot:Q09189) [Schizosaccharomyces pombe] Length = 411 Score = 25.4 bits (53), Expect = 9.7 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 118 EKLYNSILTGDYDSAVRQSLEYESQGKGSIIENVVNNLIIDKRRNT 255 + LYN +TG S+VR L + +G I + +DK+R + Sbjct: 337 DNLYNEEITGVVVSSVRAGL--DPKGTAQKIAELARQRAVDKKRQS 380 >At5g66720.1 68418.m08410 5-azacytidine resistance protein -related contains weak similarity to 5-azacytidine resistance protein azr1 (Swiss-Prot:Q09189) [Schizosaccharomyces pombe] Length = 414 Score = 25.4 bits (53), Expect = 9.7 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 118 EKLYNSILTGDYDSAVRQSLEYESQGKGSIIENVVNNLIIDKRRNT 255 + LYN +TG S+VR L + +G I + +DK+R + Sbjct: 340 DNLYNEEITGVVVSSVRAGL--DPKGTAQKIAELARQRAVDKKRQS 383 >At5g46130.1 68418.m05673 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 376 Score = 25.4 bits (53), Expect = 9.7 Identities = 18/75 (24%), Positives = 32/75 (42%), Gaps = 1/75 (1%) Frame = +1 Query: 46 AMCMLAASAGV-VELSADTSNQDLEEKLYNSILTGDYDSAVRQSLEYESQGKGSIIENVV 222 AM M +GV + + +TS +D++ N + S+ KGS I+N+ Sbjct: 80 AMSMGLNQSGVNIHMKENTSLRDMDNVRLNIYYKPSDPKSKSVSVHLPPLPKGSQIQNIA 139 Query: 223 NNLIIDKRRNTWSTA 267 + D + + W A Sbjct: 140 MTSLPDLKNDDWVVA 154 >At4g37690.1 68417.m05332 galactosyl transferase GMA12/MNN10 family protein low similarity to alpha-1,2-galactosyltransferase, Schizosaccharomyces pombe [SP|Q09174] Length = 432 Score = 25.4 bits (53), Expect = 9.7 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 199 PCLGSHIPSSDGQHC 155 PC G H PS DG C Sbjct: 374 PCSGDHNPSYDGDTC 388 >At4g17330.1 68417.m02600 agenet domain-containing protein contains Pfam PF05641: Agenet domain Length = 1058 Score = 25.4 bits (53), Expect = 9.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 122 NCTTASSPATTTVLSVRAWNMR 187 N T PA L+++AWN+R Sbjct: 713 NTVTVHFPAEEETLTIKAWNLR 734 >At4g01930.1 68417.m00257 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 25.4 bits (53), Expect = 9.7 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 29 NFSLYLRCACSPPARASLN 85 NF+L +RC +PP ++ LN Sbjct: 219 NFTLDMRCVLNPPQQSLLN 237 >At1g67310.1 68414.m07661 calmodulin-binding protein similar to anther ethylene-upregulated calmodulin-binding protein ER1 GI:11612392 from[Nicotiana tabacum] Length = 1035 Score = 25.4 bits (53), Expect = 9.7 Identities = 22/88 (25%), Positives = 42/88 (47%) Frame = +1 Query: 13 APNKMKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDYDSAVRQSLEYESQ 192 +PN++ LLV F +L+ + + + ++ N L KL D V ++ S Sbjct: 571 SPNELILLVRFVQTLLSDRSSERKSNLESGNDKLLTKLK---ADDDQWRHVIGTIIDGSA 627 Query: 193 GKGSIIENVVNNLIIDKRRNTWSTATSC 276 S ++ ++ L+ DK +TW ++ SC Sbjct: 628 SSTSTVDWLLQELLKDK-LDTWLSSRSC 654 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,270,072 Number of Sequences: 28952 Number of extensions: 136385 Number of successful extensions: 420 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 399440640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -