BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20044 (595 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 25 0.36 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 1.5 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 3.4 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 5.9 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 25.4 bits (53), Expect = 0.36 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +2 Query: 344 VATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVY 496 + + +D K E H+E+ A + E+R+ + +G+ T L + VY Sbjct: 172 IVGESVIDEKAEEHKEQFTALVREIRNAFRH--DGLLLTMSVLPNVNSSVY 220 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +3 Query: 60 AMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSP 185 A T T+++ + S V A P G+P P + SP Sbjct: 194 ASRTTTSPTKVKASKASPAAAPRSV--ATPTGIPTPSTSASP 233 Score = 21.8 bits (44), Expect = 4.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 187 SGESARRGTGTPTGSASITSYARPP 113 S +A R TPTG + ++ A PP Sbjct: 210 SPAAAPRSVATPTGIPTPSTSASPP 234 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.2 bits (45), Expect = 3.4 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = +2 Query: 422 SRLKDHLEGVEKTRLTLEQQTAEVYKAIEIR*PQLP 529 S++K H++G+ ++L + ++ + PQLP Sbjct: 232 SKIKKHIDGMAASKLNVLHWHITDSQSFPLELPQLP 267 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 5.9 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = +2 Query: 344 VATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVY 496 VA + LD H E+ + + ELR K E + T L + VY Sbjct: 180 VAGDKVLDENAAEHREQFVSLVRELRGAFK--AENLLVTLTVLPNVNSTVY 228 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,937 Number of Sequences: 336 Number of extensions: 1549 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -