BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20044 (595 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) 36 0.019 SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_12374| Best HMM Match : SlyX (HMM E-Value=1.2) 29 2.1 SB_46938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_32051| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 29 3.7 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 28 4.9 SB_44118| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) 28 4.9 SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) 28 6.5 SB_37659| Best HMM Match : Motilin_ghrelin (HMM E-Value=3.2) 28 6.5 SB_21209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_18775| Best HMM Match : DUF1409 (HMM E-Value=0.78) 27 8.6 SB_58439| Best HMM Match : L15 (HMM E-Value=1e-05) 27 8.6 SB_50620| Best HMM Match : Lectin_C (HMM E-Value=2.1e-14) 27 8.6 SB_45490| Best HMM Match : zf-U1 (HMM E-Value=0.51) 27 8.6 SB_21190| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) Length = 299 Score = 36.3 bits (80), Expect = 0.019 Identities = 19/55 (34%), Positives = 31/55 (56%) Frame = +2 Query: 314 IRSEQTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQ 478 I EQ +E + KME +EKR++Y+ L++RL + VE+ R T+E+ Sbjct: 189 IAQEQIEQQSKLIEEKIMQKMEMTKEKRDSYMEALKTRLHEKSLDVEQKRQTMEE 243 >SB_14299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +2 Query: 347 ATKEALDAKMETHEEKREAYINELRSRLKDHLEG-VEKTRLTLEQQTAEVYKAIEI 511 A ++AL+A +E R+ + ELR ++ + E +E+ R+ E+Q AE+ EI Sbjct: 52 AIRDALNAAEAKAQEDRKQALEELRKKMNEEREQCLEQARIRAEEQMAEIRYRCEI 107 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 483 PRKCTRPSK*DDHSCRQAXREPQEDDRASARNMR 584 PRK R + DD + R+ R+P+ DDR ++ R Sbjct: 282 PRKVDREPRRDDRATRKDDRQPRGDDRGQMKDDR 315 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +3 Query: 474 NSRPRKCTRPSK*DDHSCRQAXREPQEDDRASARNMR 584 +S+ RK + + DD R+ REP+ DDRA+ ++ R Sbjct: 321 DSKLRKDNKGPRKDDREPRRDDREPRRDDRATRKDDR 357 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 471 WNSRPRKCTRPSK*DDHSCRQAXREPQEDDRASARNMR 584 W+ R R R K D R+ REP+ DDRA+ ++ R Sbjct: 265 WD-RQRFGERTEKHQDREPRKVDREPRRDDRATRKDDR 301 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 483 PRKCTRPSK*DDHSCRQAXREPQEDDRASARNMR 584 PR+ R + DD + R+ R+P+ DDR ++ R Sbjct: 338 PRRDDREPRRDDRATRKDDRQPRGDDRGQMKDDR 371 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 29.5 bits (63), Expect = 2.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +3 Query: 66 EVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKT--PSVEEIQEKLKAXEE 239 E E TE + ++ G + + LA +GV P ADS E+ P +EK E Sbjct: 285 EEENSETEEQPRKPVGGPINFAAELASKIGVAPPPAADSDEEAAEPGAWSDEEKKPQQPE 344 Query: 240 RRRS 251 ++RS Sbjct: 345 KQRS 348 >SB_12374| Best HMM Match : SlyX (HMM E-Value=1.2) Length = 157 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/69 (26%), Positives = 32/69 (46%) Frame = +3 Query: 51 KVEAMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKTPSVEEIQEKLKA 230 ++E + KSTE+R QE YE +E + +T +E ++EK + Sbjct: 46 ELEPLAEMLKSTELRLQEAQDRLFTYERRASEHTKLIAELTQKVESQTDQLEHMREKYRL 105 Query: 231 XEERRRSLK 257 ++ RSL+ Sbjct: 106 TQDEYRSLQ 114 >SB_46938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/69 (26%), Positives = 32/69 (46%) Frame = +3 Query: 51 KVEAMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKTPSVEEIQEKLKA 230 ++E + KSTE+R QE YE +E + +T +E ++EK + Sbjct: 67 ELEPLAEMLKSTELRLQEAQDRLFTYERRASEHTKLIAELTQKVESQTDQLEHMREKYRL 126 Query: 231 XEERRRSLK 257 ++ RSL+ Sbjct: 127 TQDEYRSLQ 135 >SB_32051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1090 Score = 29.5 bits (63), Expect = 2.1 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +3 Query: 66 EVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKT--PSVEEIQEKLKAXEE 239 E E TE + ++ G + + LA +GV P ADS E+ P +EK E Sbjct: 149 EEENSETEEQPRKPVGGPINFAAELASKIGVAPPPAADSDEEAAEPGAWSDEEKKPQQPE 208 Query: 240 RRRS 251 ++RS Sbjct: 209 KQRS 212 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 353 KEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTA 487 K+ D+ E H+E ++ + E K H+E ++ T + +EQQ A Sbjct: 1422 KKVQDSSNEIHKENQD--LREELKMAKRHIESLKSTLIQVEQQAA 1464 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = +2 Query: 347 ATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIE 508 + KE +M T +EK + + ++L+D L K++ Q+ +E Y+A++ Sbjct: 423 SNKEKEYKRMATEQEKESKSLRKKNNQLEDELTNQGKSKEQEAQEHSEKYEALK 476 >SB_44118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 611 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -3 Query: 305 PPRSWPSSEQWRPSY 261 PP ++PSS+QW P+Y Sbjct: 508 PPGAYPSSDQWIPAY 522 >SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 1997 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +2 Query: 308 SRIRSEQTNNFIVATK-EALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQT 484 SR+ SE + I K + +A +E ++K + INE R +L++ ++ ++ + Sbjct: 1455 SRLNSELEDALIDLEKAQTNNANLEKKQKKIDIQINEWRVKLEEVQADLDNSQKEARNYS 1514 Query: 485 AEVYK 499 E+YK Sbjct: 1515 TEMYK 1519 >SB_56390| Best HMM Match : CHASE3 (HMM E-Value=0.042) Length = 440 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = +2 Query: 359 ALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEV 493 AL K + + +N+ +L + +EG++ T +TL+QQ ++ Sbjct: 235 ALQKKYSDELKSSQDELNDFVIQLDEEVEGMQSTIMTLQQQIKDI 279 >SB_37659| Best HMM Match : Motilin_ghrelin (HMM E-Value=3.2) Length = 468 Score = 27.9 bits (59), Expect = 6.5 Identities = 20/61 (32%), Positives = 25/61 (40%) Frame = +3 Query: 75 TKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKTPSVEEIQEKLKAXEERRRSL 254 T T R QE G +A P V V +ADS P +E+ +A E SL Sbjct: 237 TSETTERDQEHDTGDIALPQYKGAPPLVVVAEQADSVASAPETLAAREEGEAVVESNSSL 296 Query: 255 K 257 K Sbjct: 297 K 297 >SB_21209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 189 KTPSVEEIQEKLKAXEERRR 248 K P + E+QEKLKA +E RR Sbjct: 281 KDPKLLELQEKLKAKKEERR 300 >SB_7677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 27.9 bits (59), Expect = 6.5 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +2 Query: 326 QTNNFIVATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEK--TRLTLEQQTAEVYK 499 QT I+ E ME + + E EL +L+ K T+L L Q+TAE YK Sbjct: 401 QTQILILQVHEDYRKLMEQKQAEEERCRKELEEKLQTLERDSHKYRTKLELAQKTAETYK 460 >SB_18775| Best HMM Match : DUF1409 (HMM E-Value=0.78) Length = 356 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/67 (25%), Positives = 35/67 (52%) Frame = +3 Query: 48 LKVEAMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKTPSVEEIQEKLK 227 + +E +++ K+ I ++K ++++ + +P AD K P EEI EKLK Sbjct: 162 ITMEQSQIQLKTINIPLDGINKSPA--QLMIGRRLKTSLPATADLL-KPPGQEEITEKLK 218 Query: 228 AXEERRR 248 +E+++ Sbjct: 219 KIKEKQK 225 >SB_58439| Best HMM Match : L15 (HMM E-Value=1e-05) Length = 203 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 69 VETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEK 191 +E + +I C +K GL + + G P+PRRA P K Sbjct: 127 IERQGGKITCAHYNKLGLRVLLKPEKFEGKPIPRRAHPPSK 167 >SB_50620| Best HMM Match : Lectin_C (HMM E-Value=2.1e-14) Length = 620 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/29 (37%), Positives = 21/29 (72%), Gaps = 2/29 (6%) Frame = +3 Query: 78 KSTEIRCQEMSKGGLAYEVI--LAEPVGV 158 K+TE++CQ +++GG+A + + E +GV Sbjct: 202 KNTELQCQSINRGGVAKASVMYIVEDIGV 230 >SB_45490| Best HMM Match : zf-U1 (HMM E-Value=0.51) Length = 477 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = +3 Query: 87 EIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKTPSVEEIQEKLKAXEERRRSLK 257 E+ E+ K A A P AD P + S E EK+ A ++ R+LK Sbjct: 328 EVESVEVKKEEDATAQASATPATTEAKEEADKPAEAASENEGSEKMDAKQQPPRALK 384 >SB_21190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/57 (29%), Positives = 24/57 (42%) Frame = +3 Query: 87 EIRCQEMSKGGLAYEVILAEPVGVPVPRRADSPEKTPSVEEIQEKLKAXEERRRSLK 257 E+ E+ K A A P AD P + S E EK+ A ++ R+LK Sbjct: 328 EVESVEVKKEEDATAQASATPATTEAKEEADKPAEAASENEGSEKMDAKQQPPRALK 384 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,837,981 Number of Sequences: 59808 Number of extensions: 246978 Number of successful extensions: 1058 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1055 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -