BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20042 (613 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 23 2.0 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 23 2.0 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 2.7 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 22 4.7 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 560 SRVKKPSVVLVQLLVPKRSDPSSTARTRFTISSA 459 S ++ P+V +Q P+R+ P++ R R +SA Sbjct: 65 SVLQLPTVTEIQETQPQRTKPTAGKRARTAYTSA 98 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 560 SRVKKPSVVLVQLLVPKRSDPSSTARTRFTISSA 459 S ++ P+V +Q P+R+ P++ R R +SA Sbjct: 56 SVLQLPTVTEIQETQPQRTKPTAGKRARTAYTSA 89 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = +2 Query: 359 WV*LISFMRHSRTGATLQTHCAQQLVQTPI*KWRRC 466 W+ F+ H G L H QL+ P + RC Sbjct: 667 WLFHCHFLFHIVIGMNLIIHVGTQLIYRPFSHFPRC 702 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 Query: 541 DGFLTRDNLQERM 579 DG+L DNL ERM Sbjct: 153 DGWLFGDNLSERM 165 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,354 Number of Sequences: 336 Number of extensions: 2654 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -