BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20041 (616 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 25 0.51 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 25 0.51 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 24 0.88 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 3.6 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 21 6.2 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 25.0 bits (52), Expect = 0.51 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 202 LGRVQQRRGGASESLSKRLEYRTGPALLQC 291 LGR++ GG + LS E T P L+ C Sbjct: 214 LGRIKGISGGEKKRLSFAAEVLTNPKLMFC 243 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 25.0 bits (52), Expect = 0.51 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 202 LGRVQQRRGGASESLSKRLEYRTGPALLQC 291 LGR++ GG + LS E T P L+ C Sbjct: 214 LGRIKGISGGEKKRLSFAAEVLTNPKLMFC 243 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 24.2 bits (50), Expect = 0.88 Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Frame = -1 Query: 220 SVVLFRAT---AAIRIEKRPAITHCLTMCLRVRHTRVLVSASFYITVHTTVP 74 +VV + +T A+ I++ AITH + + RVLV ++ +++ ++P Sbjct: 127 AVVTYSSTYVLVALSIDRYDAITHPMNFSGSWKRARVLVMLAWLLSILFSLP 178 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.2 bits (45), Expect = 3.6 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 521 HIRLFIWMCKFY 486 H+R F+ +C FY Sbjct: 534 HVRAFLGLCNFY 545 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 317 PDAIDLFSSRTSEKRSE 367 PDAI+ S+ SEK+ E Sbjct: 70 PDAIETDCSKCSEKQKE 86 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,342 Number of Sequences: 336 Number of extensions: 3074 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -