BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20040 (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 24 1.3 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 24 1.3 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 24 1.3 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 23 2.9 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 22 3.9 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 22 3.9 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 22 3.9 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 3.9 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 22 3.9 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 22 3.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.1 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 22 5.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 6.8 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 379 RHHIRVINRHAHYFSNSIRFQ 317 RHH V + H H+F + ++Q Sbjct: 117 RHHEEVADGHQHHFLHENKYQ 137 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 379 RHHIRVINRHAHYFSNSIRFQ 317 RHH V + H H+F + ++Q Sbjct: 117 RHHEEVADGHQHHFLHENKYQ 137 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 379 RHHIRVINRHAHYFSNSIRFQ 317 RHH V + H H+F + ++Q Sbjct: 117 RHHEEVADGHQHHFLHENKYQ 137 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 22.6 bits (46), Expect = 2.9 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +2 Query: 242 ICGAGAFTPGCSKTHLPGYVQNADKLKSDGVAEIVCVSVNDP 367 +C G+ G G N +K SDG E C NDP Sbjct: 116 LCPDGSLACGDGNCIERGLFCNGEKDCSDGSDENTCDIDNDP 157 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 315 LSAFCTYPGKCVLEHPGVKAPAPQIIQPSFPPS 217 +S+F PG + + + + ++ P FPPS Sbjct: 2 MSSFLMNPGTALPTYQQPQHISGVVVDPKFPPS 34 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 315 LSAFCTYPGKCVLEHPGVKAPAPQIIQPSFPPS 217 +S+F PG + + + + ++ P FPPS Sbjct: 2 MSSFLMNPGTALPTYQQPQHISGVVVDPKFPPS 34 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 236 CIICGAGAFTPGCSKTHL 289 C ICG T G KTH+ Sbjct: 165 CKICGRAFTTKGNLKTHM 182 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 236 CIICGAGAFTPGCSKTHL 289 C ICG P KTHL Sbjct: 252 CRICGKSYARPSTLKTHL 269 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 315 LSAFCTYPGKCVLEHPGVKAPAPQIIQPSFPPS 217 +S+F PG + + + + ++ P FPPS Sbjct: 2 MSSFLMNPGTALPTYQQPQHISGVVVDPKFPPS 34 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 315 LSAFCTYPGKCVLEHPGVKAPAPQIIQPSFPPS 217 +S+F PG + + + + ++ P FPPS Sbjct: 2 MSSFLMNPGTALPTYQQPQHISGVVVDPKFPPS 34 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 383 KPPSHTGH*QTRT 345 +PPS T H QT+T Sbjct: 1175 RPPSTTNHWQTKT 1187 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.8 bits (44), Expect = 5.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 239 YNLLSRRQLTNIHLISGRIFE*ISSRQLIPD 147 YN +RQ +I L SGR S L+ D Sbjct: 157 YNPSQKRQFLHITLASGRTLTVTPSHLLVLD 187 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 147 VGDQLPAADLFEDSPANK 200 V +PA D+FE+ NK Sbjct: 1510 VASSIPAKDVFENGHVNK 1527 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 147 VGDQLPAADLFEDSPANK 200 V +PA D+FE+ NK Sbjct: 1510 VASSIPAKDVFENGHVNK 1527 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 147 VGDQLPAADLFEDSPANK 200 V +PA D+FE+ NK Sbjct: 1510 VASSIPAKDVFENGHVNK 1527 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 147 VGDQLPAADLFEDSPANK 200 V +PA D+FE+ NK Sbjct: 1510 VASSIPAKDVFENGHVNK 1527 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 6.8 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +2 Query: 254 GAFTPGCSKTHLPGYVQNADKLKSDGVAEIVCVSVND 364 G F G T GY + K K G IV +S++D Sbjct: 383 GGFWVGYEDTDTAGYKASYVKAKGLGGIAIVDLSLDD 419 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,625 Number of Sequences: 336 Number of extensions: 3914 Number of successful extensions: 33 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -