BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20039 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50624| Best HMM Match : F5_F8_type_C (HMM E-Value=6e-10) 29 4.0 SB_8382| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 >SB_50624| Best HMM Match : F5_F8_type_C (HMM E-Value=6e-10) Length = 353 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +1 Query: 436 NLECSSVKSIYFAVPIYNEYARHRGIRKVTHYCCMVSV 549 N SV I PIY +Y R R ++ TH C V + Sbjct: 173 NTASDSVADIILTSPIYAKYIRLRPVQWHTHVCMRVEL 210 >SB_8382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 882 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +3 Query: 3 FILLNLECSSVKSIYSAAPIYNEYVRHRVCTKSNSLLLHGFGREATNDKRISR 161 F LL++ V + Y YNE + H +C + N+LL+ +TN +++ Sbjct: 9 FTLLSVFTLCVSASYCC---YNETIFHEICCQQNALLIDNCCDNSTNSACLNK 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,122,524 Number of Sequences: 59808 Number of extensions: 457122 Number of successful extensions: 921 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 921 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -