Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20038
         (642 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    24   1.4  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       23   3.3  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   5.8  

>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +1

Query: 112 TELPKDSRSSKRMCSLSVNQATESVLAHCTVSWSSAH 222
           T L  DSRS++RM + SVN     +L    + W   H
Sbjct: 272 TVLWLDSRSTERMIAASVNLICH-ILCMSDLHWQLPH 307


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +3

Query: 237 CYIEANASTWVN 272
           CY   NA+TW N
Sbjct: 539 CYFRRNAATWKN 550


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +1

Query: 421  SPAARCIPPPRL 456
            +P  RC PPPR+
Sbjct: 1696 APNRRCPPPPRM 1707


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 178,384
Number of Sequences: 438
Number of extensions: 4075
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19315974
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)