BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20035 (540 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe... 51 1e-07 >SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 273 Score = 50.8 bits (116), Expect = 1e-07 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 2/52 (3%) Frame = +3 Query: 291 LSPNIEIGRI*PPSRITP--FNPFQIPLLNTIILIRSGVTVT*AHHXLIXNN 440 LSP E+G + PP I +P ++PLLNT+IL+ SG ++T AH+ LI N Sbjct: 116 LSPTFELGAVWPPVGIADKTIDPLEVPLLNTVILLTSGASLTYAHYSLIARN 167 Score = 27.5 bits (58), Expect = 1.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 139 YQ*WRDISREGTYQGKHTILVNKGLR*G 222 Y +RD+S E G HT V KGL+ G Sbjct: 65 YLWFRDMSTEANIHGAHTKAVTKGLKIG 92 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,443,186 Number of Sequences: 5004 Number of extensions: 20190 Number of successful extensions: 30 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -