BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20034 (519 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 2.7 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 8.1 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 2.7 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 254 KLLAKITSLNESPSVHGIIVQMPXXSDHAXDAHR 355 ++L ITSL S + G++VQ D DA R Sbjct: 1633 EILIFITSLRVSVWLEGVVVQETLLEDVKSDAER 1666 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 22.6 bits (46), Expect = 8.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 55 QDL*KMTCVNK*RGCVQNGLASSPGLPS 138 +++ K+ CV+ R VQN S P L S Sbjct: 385 EEMRKVVCVDNYRPSVQNRWTSDPFLAS 412 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 455,701 Number of Sequences: 2352 Number of extensions: 7107 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47360208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -