BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20033 (729 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 24 1.4 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 1.9 AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 22 4.4 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 5.8 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 7.7 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 22 ALVLCGLLAAVSAAPQYY 75 A++LC L AVSAA Y Sbjct: 6 AVILCAFLVAVSAAENKY 23 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 381 NLPWDVNSEGSWV 419 N WDV+S GSW+ Sbjct: 187 NAWWDVHSTGSWL 199 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/27 (37%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +1 Query: 178 EMQHLDNMMKELSLKFPSI-INEGRVE 255 EM++L+ ++KE +PS+ + E R+E Sbjct: 43 EMKYLEMVLKEAQRLYPSVPVIERRLE 69 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.8 bits (44), Expect = 5.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 16 MIALVLCGLLAAVSAAPQYYHGSSHWPYHHYD 111 MI L+ + AVSAAP ++ S Y H D Sbjct: 1 MIPLIAIAGILAVSAAPAEFYESR---YDHLD 29 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 7.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 Query: 635 YVVASTLSRSHWSSGLSPSRRQRPA 561 Y+ L S+W LSP RQ A Sbjct: 390 YMSTIDLRSSYWQIPLSPESRQYTA 414 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,628 Number of Sequences: 336 Number of extensions: 3568 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -