BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20033 (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeo... 25 2.4 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 25 3.2 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 25 3.2 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 24 5.5 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.3 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 7.3 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.3 AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.3 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 23 9.7 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 9.7 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 9.7 AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CY... 23 9.7 AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 23 9.7 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 23 9.7 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 9.7 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 9.7 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 9.7 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 9.7 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 9.7 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 9.7 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 9.7 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 9.7 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 9.7 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 9.7 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 9.7 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 9.7 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 9.7 >AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeotic protein protein. Length = 324 Score = 25.0 bits (52), Expect = 2.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 189 LGQHDEGAVVEVPQHYKRRTRGGDKYQISIH 281 +G H A + +PQH+ ++G + Y +H Sbjct: 149 MGHHMGTAQMTIPQHHMGHSQGQECYPEQVH 179 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 24.6 bits (51), Expect = 3.2 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 103 HYDPFSPYVRESMLDTHSLWSNLANEMQHLDNMMKELSLK 222 +Y P SPY R ML +L L+ +Q +D +MK+ L+ Sbjct: 4 YYHPASPYCRSVMLVAKAL--KLSLNLQFVD-LMKDEQLR 40 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -2 Query: 680 YGIGKNSASSLMLTAYVVASTLSRSHWSSGL 588 +G+ + S SS+ LTA+V S + S + + + Sbjct: 912 FGVWEKSGSSVFLTAFVATSMQTASKYMNDI 942 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 175 NEMQHLDNMMKELSLKFPSIINEGRVEATSIR 270 ++M++LD ++KE K+P + R+ A R Sbjct: 350 HDMKYLDQILKESLRKYPPVPMHFRMTAQDYR 381 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 7.3 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +2 Query: 341 AG*QCF*SLLXNTEPSL----GCEFRRQLGLRERRVE 439 AG F +++ ++ PS+ G E +Q+GL ERRV+ Sbjct: 540 AGKTTFSNIIGSSGPSVTSCTGSEIDKQVGLWERRVK 576 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 7.3 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +3 Query: 537 WSSPPRATCGTLTSAWRQP 593 WS PR T T+ W P Sbjct: 174 WSDQPRPPTTTTTTVWTDP 192 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 169 LANEMQHLDNMMKELSLKFPSIINEGR 249 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPMIGR 80 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 169 LANEMQHLDNMMKELSLKFPSIINEGR 249 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPMFGR 80 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +1 Query: 88 HWPYHHYDPFSPYV--RESMLDTHS 156 HW +HH S YV R +L+T++ Sbjct: 298 HWQHHHSHHRSAYVQNRVQLLETNT 322 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 9.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 148 THSLWSNLANEMQHLDNMMKELSLKFPSIINEGRVE 255 +H L+ L NE+ ++ + +L F S I+ R+E Sbjct: 1486 SHRLYDVLGNEIGRINKLGSIENLSFQSRISNCRIE 1521 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 9.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 148 THSLWSNLANEMQHLDNMMKELSLKFPSIINEGRVE 255 +H L+ L NE+ ++ + +L F S I+ R+E Sbjct: 1487 SHRLYDVLGNEIGRINKLGSIENLSFQSRISNCRIE 1522 >AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CYP4D15 protein. Length = 151 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 169 LANEMQHLDNMMKELSLKFPSIINEGR 249 + N+M +LD ++KE +PS+ GR Sbjct: 54 MLNDMHYLDLVIKETLRLYPSVPLFGR 80 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = +3 Query: 276 IHLPGYEQKDINVKAKNGVLMVQANSAFNHYXKIQNLPWDV 398 +H+P YE + + +G++ N+ F+ + PW V Sbjct: 106 VHIPPYEIEGCGHRNPHGMIFTIENNQFSE-SEYGEYPWTV 145 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.0 bits (47), Expect = 9.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 27 SVVRTAGGGLGRATVLPWLVTLAVSPLRPLQS 122 S V A GL T PWLVT + S L+ S Sbjct: 83 SSVGGAQSGLPDITRHPWLVTASQSALQKFAS 114 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 224 HGPSHLSHHHY 234 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 253 HGPSHLSHHHY 263 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 76 HGSSHWPYHHY 108 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 776,304 Number of Sequences: 2352 Number of extensions: 16282 Number of successful extensions: 103 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -