BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20032 (758 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F7.06c |pol4||DNA polymerase X family|Schizosaccharomyces p... 26 5.1 SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase... 26 6.7 SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyce... 25 8.9 SPBC577.05c |rec27|mug41|meiotic recombination protein Rec27|Sch... 25 8.9 SPBC23E6.07c |rfc1||DNA replication factor C complex subunit Rfc... 25 8.9 >SPAC2F7.06c |pol4||DNA polymerase X family|Schizosaccharomyces pombe|chr 1|||Manual Length = 506 Score = 26.2 bits (55), Expect = 5.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 631 LVVIDWRKGVRRSLSPKRCYVLFHGGRRP 717 +V IDW + SL+P YV++H R+P Sbjct: 75 IVKIDWLNEPKESLTPGNPYVIWH--RKP 101 >SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase Gpt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1448 Score = 25.8 bits (54), Expect = 6.7 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 86 VFTKEPMVNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYNIE 220 + TK + + D K+K +++ L P+ I IAK+YN E Sbjct: 1174 IMTKSVIEHTDKKVK----FWFIENFLSPSFKSSIPAIAKKYNFE 1214 >SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 698 Score = 25.4 bits (53), Expect = 8.9 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +1 Query: 595 WKYY-GITVTDDNLVVIDWR 651 W Y GI V DD + + DWR Sbjct: 317 WNYLSGIAVLDDRIAMHDWR 336 >SPBC577.05c |rec27|mug41|meiotic recombination protein Rec27|Schizosaccharomyces pombe|chr 2|||Manual Length = 134 Score = 25.4 bits (53), Expect = 8.9 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = +2 Query: 107 VNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYN 214 VNL K ++ ++++H+L+ ++I+ K+Y+ Sbjct: 12 VNLKKKQLQITSSEIIEHVLEELNLKNIERRVKKYD 47 >SPBC23E6.07c |rfc1||DNA replication factor C complex subunit Rfc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 934 Score = 25.4 bits (53), Expect = 8.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 464 HRTDCKGLYLPAPYESIPTSSLTAMSSVKP 553 ++ D + Y+P YES+P T S V P Sbjct: 764 NKLDLRQHYIPILYESLPVKLSTGHSDVVP 793 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,942,989 Number of Sequences: 5004 Number of extensions: 57693 Number of successful extensions: 169 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 169 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -