BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20032 (758 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_40140| Best HMM Match : SASP_gamma (HMM E-Value=0.36) 29 5.4 >SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +2 Query: 431 ACSSTLTAACFHRTDCKGL--YLPAPYESIPTSSLTAMSSVK 550 AC + + F RTDC G+ YL Y+ +P S V+ Sbjct: 304 ACEVSASPVFFDRTDCTGVYKYLRINYDCLPEESRVKFDDVR 345 >SB_40140| Best HMM Match : SASP_gamma (HMM E-Value=0.36) Length = 704 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 176 MFEDIKEIAKEYNIEKSCDKYMNV-DVVSSSWRCIRWACSRVE 301 + E++ EI + +I+++ +NV D++ SSW + AC E Sbjct: 282 VMEEVAEIPEVSDIDRNSSMKVNVMDLIESSWEQMEQACDTEE 324 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,804,725 Number of Sequences: 59808 Number of extensions: 470686 Number of successful extensions: 1139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -