BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20028 (615 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 24 1.0 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 24 1.0 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 24 1.0 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 3.1 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 3.1 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 4.1 EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 21 7.2 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 9.6 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 24.2 bits (50), Expect = 1.0 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 475 GRPATLAVESLGCHRNS 525 GR ++LAV+SL C+ NS Sbjct: 183 GRLSSLAVQSLDCNTNS 199 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 24.2 bits (50), Expect = 1.0 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 475 GRPATLAVESLGCHRNS 525 GR ++LAV+SL C+ NS Sbjct: 183 GRLSSLAVQSLDCNTNS 199 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 24.2 bits (50), Expect = 1.0 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 475 GRPATLAVESLGCHRNS 525 GR ++LAV+SL C+ NS Sbjct: 183 GRLSSLAVQSLDCNTNS 199 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 366 LVDDQISLSGPHGIIGRAVVLHEKADDYGKSDHPDSRK 479 ++D+ I LSG G V+LH + + D++K Sbjct: 401 ILDEPIELSGYRLTAGTVVLLHTWIAGLNEENFKDAKK 438 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.6 bits (46), Expect = 3.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 255 SHFNPEHKDHGHPNDVNRHV 314 S F+ + KD G PND N ++ Sbjct: 345 SSFDFQSKDQGPPNDGNGNI 364 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 482 RQRWRSSRLGVIG 520 RQ WR SRL +G Sbjct: 90 RQSWRDSRLSFLG 102 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 21.4 bits (43), Expect = 7.2 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +3 Query: 246 IDWSHFNPEHKDHGHPNDVNR 308 ++W+ +PE D G P R Sbjct: 117 LEWNAAHPEEDDGGQPRPPGR 137 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 157 VHVQGGITGL 186 +HV GG+TGL Sbjct: 205 IHVVGGLTGL 214 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,803 Number of Sequences: 438 Number of extensions: 3721 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -