BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20026 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 29 0.13 AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 24 4.8 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 23 8.4 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 29.1 bits (62), Expect = 0.13 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 337 SEDGQDRGGVPHPQRADE*--LHRRHQGGARRQDGDPRGKTRGLHQR 471 ++ G + GV PQ++ + HR+HQ +Q+G + + G+HQ+ Sbjct: 248 NQRGNKQNGVNLPQQSAQRQPAHRQHQQWPHQQNGQQQQQRMGIHQQ 294 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 526 LEQQTAEVYKAIEDKMTTAADKRDENLKKMIERLRE 633 L+ + + K +E + T + D+N KK IER E Sbjct: 36 LKGEVEKQSKKLEKRKETLGESLDKNHKKKIERDEE 71 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -2 Query: 214 TPTGSASITSYARPPFDISWQRISVDLVSTSMAST 110 TP S+ +ARP +++ +S+ +T +A T Sbjct: 650 TPNSVGSLQEFARPYRNMATTPVSIRFTNTVIART 684 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 488,069 Number of Sequences: 2352 Number of extensions: 7971 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -