BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20025 (670 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0300 + 14782156-14782225,14782708-14782780,14782800-147830... 29 3.3 12_02_0729 + 22611836-22612028,22612297-22612376 28 7.7 >01_03_0300 + 14782156-14782225,14782708-14782780,14782800-14783076, 14783715-14783885,14783992-14784012 Length = 203 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = +1 Query: 517 DHGLPIPSTCCSAQEINDGVVAACTENSTNXPLRRDVLLNWLFT*RTLVWC 669 DH L P+TC + + A ST+ +RR +L W WC Sbjct: 61 DHLLGPPTTCARRSTTGERRMQAVVAGSTSAGVRRHEVLQWRRAWDNRSWC 111 >12_02_0729 + 22611836-22612028,22612297-22612376 Length = 90 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -2 Query: 615 KWXVGRVLGAGRDDAVIDLLGGAARARYGQTVIGPVAG 502 +W V G G DDAV + G AR R G+ + P G Sbjct: 26 EWSVKTKEGGGGDDAVEEEDEGKARWRKGRRALDPSGG 63 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,082,030 Number of Sequences: 37544 Number of extensions: 379923 Number of successful extensions: 989 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 989 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -