BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20025 (670 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility pro... 25 2.9 AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility pro... 25 2.9 AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility pro... 25 2.9 AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility pro... 25 2.9 AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility pro... 25 2.9 AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility pro... 25 2.9 AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility pro... 25 2.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.9 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.9 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 24 3.8 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 24 3.8 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 5.0 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 8.7 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 23 8.7 >AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 19 TKHVLLYPGFQFRTNRLVHK 38 >AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 19 TKHVLLYPGFQFRTNRLVHK 38 >AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 21 TKHVLLYPGFQFRTNRLVHK 40 >AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 21 TKHVLLYPGFQFRTNRLVHK 40 >AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 534 TEHVLLRPGDQ*RRRRGLHR 593 T+HVLL PG Q R R +H+ Sbjct: 22 TKHVLLYPGFQFRTNRLVHK 41 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.6 bits (51), Expect = 2.9 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -3 Query: 188 GEVHVRIRVYFSPDANYQDDQSRNGKQKIEAKHEVLYTGHSTF 60 G+V +++R + D D S K H +YTG S F Sbjct: 733 GQVRIQLRDHLGSDTVAVDGSSIPPLGKFPVIHYEMYTGESFF 775 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.6 bits (51), Expect = 2.9 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -3 Query: 188 GEVHVRIRVYFSPDANYQDDQSRNGKQKIEAKHEVLYTGHSTF 60 G+V +++R + D D S K H +YTG S F Sbjct: 734 GQVRIQLRDHLGSDTVAVDGSSIPPLGKFPVIHYEMYTGESFF 776 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 388 RFGYAQPERFHYSISGRQER 447 ++ YAQP+R H S+ G Q++ Sbjct: 4 QYQYAQPQRQHPSLVGPQQQ 23 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 388 RFGYAQPERFHYSISGRQER 447 ++ YAQP+R H S+ G Q++ Sbjct: 4 QYQYAQPQRQHPSLVGPQQQ 23 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +1 Query: 388 RFGYAQPERFHYSISG--RQERPEDH*YH 468 ++ YAQP+R H S+ G Q++ + H H Sbjct: 75 QYQYAQPQRQHPSLVGPQLQQQQQQHQQH 103 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.0 bits (47), Expect = 8.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 484 MLRYKQSGHWADHGLP 531 +LRY S HW HGLP Sbjct: 16 VLRYIYS-HWERHGLP 30 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.0 bits (47), Expect = 8.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 484 MLRYKQSGHWADHGLP 531 +LRY S HW HGLP Sbjct: 16 VLRYIYS-HWERHGLP 30 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,835 Number of Sequences: 2352 Number of extensions: 14249 Number of successful extensions: 73 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -