BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20024 (685 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC084579-1|AAH84579.1| 343|Homo sapiens chromosome 18 open read... 34 0.41 AL832027-1|CAD89920.1| 312|Homo sapiens hypothetical protein pr... 34 0.41 AL713661-1|CAD28470.1| 196|Homo sapiens hypothetical protein pr... 34 0.41 >BC084579-1|AAH84579.1| 343|Homo sapiens chromosome 18 open reading frame 25 protein. Length = 343 Score = 34.3 bits (75), Expect = 0.41 Identities = 19/54 (35%), Positives = 26/54 (48%) Frame = +1 Query: 484 KQQSLLQDLSTEDKQYLKLDNTKGSSDDRIIYGDSTADTFKHHWYLEPSMYESD 645 K+ +LLQD ST D +T S DD + G S T + +L+P SD Sbjct: 196 KKYNLLQDSSTSDSDLTCDSSTSSSDDDEEVSGSSKTITAEIPGHLDPGFLASD 249 >AL832027-1|CAD89920.1| 312|Homo sapiens hypothetical protein protein. Length = 312 Score = 34.3 bits (75), Expect = 0.41 Identities = 19/54 (35%), Positives = 26/54 (48%) Frame = +1 Query: 484 KQQSLLQDLSTEDKQYLKLDNTKGSSDDRIIYGDSTADTFKHHWYLEPSMYESD 645 K+ +LLQD ST D +T S DD + G S T + +L+P SD Sbjct: 165 KKYNLLQDSSTSDSDLTCDSSTSSSDDDEEVSGSSKTVTAEIPGHLDPGFLASD 218 >AL713661-1|CAD28470.1| 196|Homo sapiens hypothetical protein protein. Length = 196 Score = 34.3 bits (75), Expect = 0.41 Identities = 19/54 (35%), Positives = 26/54 (48%) Frame = +1 Query: 484 KQQSLLQDLSTEDKQYLKLDNTKGSSDDRIIYGDSTADTFKHHWYLEPSMYESD 645 K+ +LLQD ST D +T S DD + G S T + +L+P SD Sbjct: 49 KKYNLLQDSSTSDSDLTCDSSTSSSDDDEEVSGSSKTITAEIPGHLDPGFLASD 102 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,118,564 Number of Sequences: 237096 Number of extensions: 2254356 Number of successful extensions: 6134 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6134 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -