BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20022 (669 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0187 + 12805788-12807007,12807059-12807186,12807811-128078... 29 3.3 06_01_0728 - 5356400-5356676,5356888-5357090,5357181-5357474,535... 29 3.3 02_02_0468 + 10633992-10634064,10635998-10636130,10636244-106363... 28 7.7 >06_02_0187 + 12805788-12807007,12807059-12807186,12807811-12807859, 12808508-12808853 Length = 580 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 5/75 (6%) Frame = -1 Query: 240 LSMIRLLTTFWMMEPLPWL-----SYSKL*RTALS*SPVRMLLYSFSSRSWLEVSADSST 76 L+++ L+ W + P L + S L SP + SF S + S D++T Sbjct: 36 LALLTLIMALWQLHPYQPLVLLPAALSSSPCPLLPRSPTSGIAVSFLSTAAATNSTDTAT 95 Query: 75 TPALAASMHIANTTR 31 P A+ +A TTR Sbjct: 96 VPTTTAAARVAATTR 110 >06_01_0728 - 5356400-5356676,5356888-5357090,5357181-5357474, 5357940-5358063,5358157-5359496 Length = 745 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +3 Query: 378 RSEARFHNQSLE*ENCLRRWCRQAY*TRQLEVHYLVGEQQSVLQIHN 518 R E F + ++ ++ L+ W +AY R+ H L + +V+Q+HN Sbjct: 469 RFEGAFETRKIK-KSALKNWVVKAYLDRKSLAHSLNDTKTAVMQLHN 514 >02_02_0468 + 10633992-10634064,10635998-10636130,10636244-10636315, 10637028-10637171,10637271-10637342,10637451-10637516, 10637603-10637673,10637796-10637936,10638347-10638688, 10638989-10639383,10639481-10639795 Length = 607 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +2 Query: 119 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRNTRSTATSCGSATDRKL 298 K+Y +L AV++ +YES G + V + + RN C + T+R L Sbjct: 297 KVYKGVLPDGTKIAVKRLTDYESPGGEAAFLREVELISVAVHRNLLKLIGFCTTQTERLL 356 Query: 299 L 301 + Sbjct: 357 V 357 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,888,946 Number of Sequences: 37544 Number of extensions: 364554 Number of successful extensions: 1102 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1102 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -